Information report for 676793390
Gene Details
Functional Annotation
- Refseq: XP_006393774.1 — transcription factor VIP1
- Swissprot: Q9MA75 — VIP1_ARATH; Transcription factor VIP1
- TrEMBL: V4JZT1 — V4JZT1_EUTSA; Uncharacterized protein
- STRING: XP_006393774.1 — (Eutrema salsugineum)
- GO:0006355 — Biological Process — regulation of transcription, DNA-templated
- GO:0007231 — Biological Process — osmosensory signaling pathway
- GO:0008272 — Biological Process — sulfate transport
- GO:0009294 — Biological Process — DNA mediated transformation
- GO:0009652 — Biological Process — thigmotropism
- GO:0009970 — Biological Process — cellular response to sulfate starvation
- GO:0045596 — Biological Process — negative regulation of cell differentiation
- GO:0051170 — Biological Process — nuclear import
- GO:0005634 — Cellular Component — nucleus
- GO:0005829 — Cellular Component — cytosol
- GO:0003682 — Molecular Function — chromatin binding
- GO:0003700 — Molecular Function — transcription factor activity, sequence-specific DNA binding
- GO:0043565 — Molecular Function — sequence-specific DNA binding
- GO:0043621 — Molecular Function — protein self-association
- GO:0051019 — Molecular Function — mitogen-activated protein kinase binding
Family Introduction
- The bZIP domain consists of two structural features located on a contiguous alpha-helix: first, a basic region of ~ 16 amino acid residues containing a nuclear localization signal followed by an invariant N-x7-R/K motif that contacts the DNA; and, second, a heptad repeat of leucines or other bulky hydrophobic amino acids positioned exactly nine amino acids towards the C-terminus, creating an amphipathic helix. To bind DNA, two subunits adhere via interactions between the hydrophobic sides of their helices, which creates a superimposing coiled-coil structure. The ability to form homo- and heterodimers is influenced by the electrostatic attraction and repulsion of polar residues flanking the hydrophobic interaction surface of the helices.
- Plant bZIP proteins preferentially bind to DNA sequences with an ACGT core. Binding specificity is regulated by flanking nucleotides. Plant bZIPs preferentially bind to the A-box (TACGTA), C-box (GACGTC) and G-box (CACGTG), but there are also examples of nonpalindromic binding sites.
Literature and News
Gene Resources
Homologs
- Arabidopsis thaliana: AT1G43700.1
- Brassica napus: GSBRNA2T00046119001, GSBRNA2T00134005001, GSBRNA2T00022517001, GSBRNA2T00092035001
- Brassica oleracea: XP_013586120.1, XP_013605016.1
- Brassica rapa: XP_009145063.1
- Juglans regia: WALNUT_00012594-RA
- Populus trichocarpa: Potri.002G069500.1
- Raphanus raphanistrum: RrC21789_p1, RrC4598_p1
Sequences
CDS Sequence:
- >676793390|Sisymbrium_irio|bZIP|676793390
ATGGAACCTCCTTCCTCGTTAAGACCAAACCAACCATCAATCCTAAGCGAAATCGAACACATGCCTGAAGCGCCACGTCAGCGTATCTCACACCACCGTAGAGCTCGTTCCGACACTTTCTTCTCCGGCGGCGACTCATCAATCGACGATCTCCTCCTCTTCGATCCATCAGATGTCGATTTCTCATCTCTAGATTTCCTCAACGCTCCTTCACCACAACAACAACAACAACAACAACAATCTCCCATGGCCGTTGATTCTCCTCCTGAAGAAACCTCATCCAACGGTGCTCCTCCTCCACCGATTCCTCTCCCTCCTGGTCGTCATGTTCGTAGCTTCTCCGTTGATTCAGAGTCCGATTTCTTCGACGATCTTAACGTTACTGAGACGAAATCGAAAAGTCGTCATCATCGGAGCAACTCAATGGATGGAGCTACGAGTTCTGGTTCGTTTAACATGGATTCGATTCTTGCTGCTGCTGTTAGTTGTAAAGATGGTGTTAGTAAGAAGAATATGGGTATGGCTAGTGAAAGACTCGCTGAGCTTGCTTTGCTTGATCCTAAAAGAGCTAAACGGATTTTAGCGAATAGACAATCGGCGGCTAGGTCAAAAGAGAGGAAGATTAGGTATACGGGTGAGTTGGAGAGGAAAGTACAGACACTTCAGAATGAAGCTACTACACTGTCTGCTCAAGTCACTATGTTGCAGAGAGGAACATCAGACCTCACCACTGAAAACAAACACCTCAAAATGCGGTTGCAAGCATTAGAACAACAAGCTGAACTTAGGGATGCTTTGAATGAAGCACTGCGGGAAGAACTGAACCGACTTAAGATAGCCGCTGGAGAGATTCCTAACGGAAACGGAAATTCATACAATCGTCCTCAATTCTCATCTCAGCAACCGACAATGAATCAGTTCGGTAACAACAAGAACCAGCAGATGAACACAAACGAACAGCCATCGCGTCCAAGCTTCATGGATTTCACAAAGAGAGGCTAA
Protein Sequence:
- >676793390|Sisymbrium_irio|bZIP|676793390
MEPPSSLRPNQPSILSEIEHMPEAPRQRISHHRRARSDTFFSGGDSSIDDLLLFDPSDVDFSSLDFLNAPSPQQQQQQQQSPMAVDSPPEETSSNGAPPPPIPLPPGRHVRSFSVDSESDFFDDLNVTETKSKSRHHRSNSMDGATSSGSFNMDSILAAAVSCKDGVSKKNMGMASERLAELALLDPKRAKRILANRQSAARSKERKIRYTGELERKVQTLQNEATTLSAQVTMLQRGTSDLTTENKHLKMRLQALEQQAELRDALNEALREELNRLKIAAGEIPNGNGNSYNRPQFSSQQPTMNQFGNNKNQQMNTNEQPSRPSFMDFTKRG