Gene Details:

  • Gene ID: Zmw_sc00774.1.g00160.1
  • Gene Family: BES1 Family
  • Description: BES1 Family protein
  • Species: Zoysia matrella
  • Source: BES1 family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_025813584.1  — protein BZR1 homolog 3
  • Swissprot:  Q5Z9E5  — BZR3_ORYSJ; Protein BZR1 homolog 3
  • TrEMBL:  A0A1E5VA88  — A0A1E5VA88_9POAL; Protein BZR1-like protein 3
  • STRING:  Pavir.J12085.1.p  — (Panicum virgatum)

Family Introduction:

  • Brassinosteroids (BRs) signal through a plasma membrane-localized receptor kinase to regulate plant growth and development. We showed previously that a novel protein, BES1(BRI1-EMS-SUPPRESSOR 1), accumulates in the nucleus in response to BRs, where it plays a role in BR-regulated gene expression; however, the mechanism by which BES1 regulates gene expression is unknown. In this study, we dissect BES1 subdomains and establish that BES1 is a transcription factor that binds to and activates BR target gene promoters both in vitro and in vivo.
  • BES1 interacts with a basic helix-loop-helix protein, BIM1, to synergistically bind to E box (CANNTG) sequences present in many BR-induced promoters. Loss-of-function and gain-of-function mutants of BIM1 and its close family members display BR response phenotypes. Thus, BES1 defines a new class of plant-specific transcription factors that cooperate with transcription factors such as BIM1 to regulate BR-induced genes.

Literature:

Sequences:

CDS Sequence:
  • >Zmw_sc00774.1.g00160.1|Zoysia_matrella|BES1|Zmw_sc00774.1.g00160.1
Protein Sequence:
  • >Zmw_sc00774.1.g00160.1|Zoysia_matrella|BES1|Zmw_sc00774.1.g00160.1
    MTNGAGGGSGGLGGTRVPTWRERENNRRRERRRRAIAAKIFAGLRAYGNYNLPKHCDNNEVLKALCNEAGWTVEPDGTTYRKGCKPPLAERHDPIGRSASPSPCSSYQPSPRASYNPSPASSSFPSSGSSSHITLGGSNFIGGVEGSSLIPWLKNLSSSSSFASSSKFPQLQHLYFNGGSISAPVTPPSSSPTRTPRIKTDWENPTVQPPWAGANYASLPNSTPPSPGHQVAPDPAWLAGFQISSAGPSSPTYSLVAPNPFGIFKETVAGSSRMCTPGQSGTCSPVMGGVPAQHDVQMVDGAPDDFAFGSSSNGNIESSGLVKAWEGERIHEECASDELELTLGSSKTRADPS