Gene Details:
- Gene ID: OBART07G19930.1
- Gene Family: BES1 Family
- Description: BES1 Family protein
- Species: Oryza barthii
- Source: BES1 family gene from PlantTFDB
Protein Features:
Annotation Proteins:
- Refseq: XP_015645123.1 — protein BZR1 homolog 1
- Swissprot: B8B7S5 — BZR1_ORYSI; Protein BZR1 homolog 1
- Swissprot: Q7XI96 — BZR1_ORYSJ; Protein BZR1 homolog 1
- TrEMBL: A0A0D3GST1 — A0A0D3GST1_9ORYZ; Uncharacterized protein
- TrEMBL: A0A0E0I2U3 — A0A0E0I2U3_ORYNI; Uncharacterized protein
- TrEMBL: A0A0E0QAC1 — A0A0E0QAC1_ORYRU; Uncharacterized protein
- TrEMBL: I1QEM4 — I1QEM4_ORYGL; Uncharacterized protein
- STRING: ORUFI07G20760.1 — (Oryza rufipogon)
- STRING: ONIVA07G18390.1 — (Oryza nivara)
- STRING: ORGLA07G0256600.1 — (Oryza glaberrima)
- STRING: OBART07G19930.1 — (Oryza barthii)
Gene Ontology:
- GO:0009742 — Biological Process — brassinosteroid mediated signaling pathway
- GO:0042742 — Biological Process — defense response to bacterium
- GO:0045892 — Biological Process — negative regulation of transcription, DNA-templated
- GO:0005634 — Cellular Component — nucleus
- GO:0005829 — Cellular Component — cytosol
- GO:0001046 — Molecular Function — core promoter sequence-specific DNA binding
- GO:0003700 — Molecular Function — transcription factor activity, sequence-specific DNA binding
Family Introduction:
- Brassinosteroids (BRs) signal through a plasma membrane-localized receptor kinase to regulate plant growth and development. We showed previously that a novel protein, BES1(BRI1-EMS-SUPPRESSOR 1), accumulates in the nucleus in response to BRs, where it plays a role in BR-regulated gene expression; however, the mechanism by which BES1 regulates gene expression is unknown. In this study, we dissect BES1 subdomains and establish that BES1 is a transcription factor that binds to and activates BR target gene promoters both in vitro and in vivo.
- BES1 interacts with a basic helix-loop-helix protein, BIM1, to synergistically bind to E box (CANNTG) sequences present in many BR-induced promoters. Loss-of-function and gain-of-function mutants of BIM1 and its close family members display BR response phenotypes. Thus, BES1 defines a new class of plant-specific transcription factors that cooperate with transcription factors such as BIM1 to regulate BR-induced genes.
Literature:
- A new class of transcription factors mediates brassinosteroid-regulated gene expression in Arabidopsis. DOI: 10.1016/j.cell.2004.11.044 ; PMID: 15680330
Sequences:
CDS Sequence:
- >OBART07G19930.1|Oryza_barthii|BES1|OBART07G19930.1
ATGAGCCCCTGCTCGTCAACGCAGCTGCTGAGCGCGCCGTCGTCGTCGTTCCCGAGCCCGGTGCCGTCGTACCACGCGAGCCCGGCGTCGTCGAGCTTCCCGAGCCCCAGCCGGATAGACAACCCGAGCGCCTCCTGCCTCCTCCCGTTCCTCCGGGGGCTCCCCAACCTCCCGCCGCTCCGCGTCTCCAGCAGCGCGCCCGTCACGCCGCCGCTCTCGTCGCCGACGGCGTCGCGGCCGCCCAAGATCAGGAAGCCGGACTGGGACGTCGACCCGTTCCGGCACCCCTTCTTCGCGGTCTCCGCGCCGGCGAGCCCCACCCGCGGCCGCCGCCTTGAGCACCCGGACACGATACCGGAGTGCGACGAGTCCGACGTCTCCACGGTGGACTCCGGCCGGTGGATCAGCTTCCAGATGGCCACGACGGCGCCGACGTCGCCCACCTACAACCTCGTCAACCCGGGCGCCTCCACCTCCAACTCCATGGAGATAGAAGGGACGGCCGGCCGAGGCGGCGCGGAGTTCGAGTTCGACAAGGGGAGGGTGACGCCATGGGAGGGCGAGAGGATCCACGAGGTCGCCGCCGAGGAGCTCGAGCTCACGCTCGGCGTCGGCGCGAAATGA
Protein Sequence:
- >OBART07G19930.1|Oryza_barthii|BES1|OBART07G19930.1
MSPCSSTQLLSAPSSSFPSPVPSYHASPASSSFPSPSRIDNPSASCLLPFLRGLPNLPPLRVSSSAPVTPPLSSPTASRPPKIRKPDWDVDPFRHPFFAVSAPASPTRGRRLEHPDTIPECDESDVSTVDSGRWISFQMATTAPTSPTYNLVNPGASTSNSMEIEGTAGRGGAEFEFDKGRVTPWEGERIHEVAAEELELTLGVGAK