Gene Details:
- Gene ID: OBART02G09820.1
- Gene Family: BES1 Family
- Description: BES1 Family protein
- Species: Oryza barthii
- Source: BES1 family gene from PlantTFDB
Protein Features:
Annotation Proteins:
- Refseq: XP_015688525.1 — PREDICTED: protein BZR1 homolog 4
- Swissprot: Q6EUF1 — BZR4_ORYSJ; Protein BZR1 homolog 4
- TrEMBL: A0A0D3F2U2 — A0A0D3F2U2_9ORYZ; Uncharacterized protein
- STRING: OBART02G09820.1 — (Oryza barthii)
Gene Ontology:
- GO:0006355 — Biological Process — regulation of transcription, DNA-templated
Family Introduction:
- Brassinosteroids (BRs) signal through a plasma membrane-localized receptor kinase to regulate plant growth and development. We showed previously that a novel protein, BES1(BRI1-EMS-SUPPRESSOR 1), accumulates in the nucleus in response to BRs, where it plays a role in BR-regulated gene expression; however, the mechanism by which BES1 regulates gene expression is unknown. In this study, we dissect BES1 subdomains and establish that BES1 is a transcription factor that binds to and activates BR target gene promoters both in vitro and in vivo.
- BES1 interacts with a basic helix-loop-helix protein, BIM1, to synergistically bind to E box (CANNTG) sequences present in many BR-induced promoters. Loss-of-function and gain-of-function mutants of BIM1 and its close family members display BR response phenotypes. Thus, BES1 defines a new class of plant-specific transcription factors that cooperate with transcription factors such as BIM1 to regulate BR-induced genes.
Literature:
- A new class of transcription factors mediates brassinosteroid-regulated gene expression in Arabidopsis. DOI: 10.1016/j.cell.2004.11.044 ; PMID: 15680330
Sequences:
CDS Sequence:
- >OBART02G09820.1|Oryza_barthii|BES1|OBART02G09820.1
ATGCCGCATTTACCCTCCCCCGCGCAAGACCACCCAGGGGTAGAATGGTCATTGCGCGTCCTCCGGCCGTTACTGCTTCTCCGGCGTATTTATACGCGGCGGCGGCGGGCGATCGCGGCGAAGATCTACGCGGGGCTGCGGGCGTACGGAAACTACACGCTCCCGAAGCACTGCGACAACAACGAGGTGCTCAAGGCGCTCTGCAACGAGGCCGGCTGGACCGTCGAGCCCGACGGCACCACCTACCGCAAGGTCCCTCTTCCTCATCCTCTTCTTCTTCTTGCAAATTAA
Protein Sequence:
- >OBART02G09820.1|Oryza_barthii|BES1|OBART02G09820.1
MPHLPSPAQDHPGVEWSLRVLRPLLLLRRIYTRRRRAIAAKIYAGLRAYGNYTLPKHCDNNEVLKALCNEAGWTVEPDGTTYRKVPLPHPLLLLAN