Gene Details:

Protein Features:

Annotation Proteins:

  • Refseq:  XP_016463704.1  — PREDICTED: beta-amylase 8-like
  • Swissprot:  Q9FH80  — BAM8_ARATH; Beta-amylase 8
  • TrEMBL:  A0A1S3ZH49  — A0A1S3ZH49_TOBAC; Beta-amylase
  • STRING:  XP_009769112.1  — (Nicotiana sylvestris)

Gene Ontology:

  • GO:0000272  — Biological Process — polysaccharide catabolic process
  • GO:0048831  — Biological Process — regulation of shoot system development
  • GO:0005634  — Cellular Component — nucleus
  • GO:0003700  — Molecular Function — transcription factor activity, sequence-specific DNA binding
  • GO:0016161  — Molecular Function — beta-amylase activity

Family Introduction:

  • Brassinosteroids (BRs) signal through a plasma membrane-localized receptor kinase to regulate plant growth and development. We showed previously that a novel protein, BES1(BRI1-EMS-SUPPRESSOR 1), accumulates in the nucleus in response to BRs, where it plays a role in BR-regulated gene expression; however, the mechanism by which BES1 regulates gene expression is unknown. In this study, we dissect BES1 subdomains and establish that BES1 is a transcription factor that binds to and activates BR target gene promoters both in vitro and in vivo.
  • BES1 interacts with a basic helix-loop-helix protein, BIM1, to synergistically bind to E box (CANNTG) sequences present in many BR-induced promoters. Loss-of-function and gain-of-function mutants of BIM1 and its close family members display BR response phenotypes. Thus, BES1 defines a new class of plant-specific transcription factors that cooperate with transcription factors such as BIM1 to regulate BR-induced genes.

Literature:

Sequences:

CDS Sequence:
  • >Niben101Scf10441g01004.1|Nicotiana_benthamiana|BES1|Niben101Scf10441g01004.1
Protein Sequence:
  • >Niben101Scf10441g01004.1|Nicotiana_benthamiana|BES1|Niben101Scf10441g01004.1
    MNNHIPHHSIPNTQDPDPQFPNPNPPPQPQPRRPRGFAATNPAAGATNKNRKEREKEKERTKLRERHRRAITSRMLAGLRQYGNFPLPVRADMNDVLAALARQAGWTVEPDGTTYRQSPPPTNNSASCMGPYQVMSVESPVSGRSLRNCSTRASVDCQPSVPRINESLSPASFDSIVVTESDTKVDKFTSTSTMNSTECLEASQIMQELHSGEHVIGLSGTQYVPVFVMLSSGVINNFCQLMDPDSLKQELQQLKSLRIDGVVVNCWWGIIESWVPQKYEWSGYRELLNIIRDFKLKLQVVMAFHENGGSDTSGMFISLPQWVLEIGKDNQDIFFTDRQGRRNTECLSWGIDKERVLRGRTAIEVYFDMMRSFRTEFDDLFADGLISAVEIGLGASGELKYPSFSERIGWRYPGIGEFQCYDKYSMLNLRKAATSRGHSFWAKGPDNAGYYNSKPHETEFFCERGDYDSYYGRFFLHWYRQVLIDHADDVLSLATLAFEGVQLVVKIPAIYWWYRTSSHAAEVTAGYYNPANQDGYSPVFEVLKRHSVTVKFICSGFQVPEIDDALADPDGLSWQILNSAWDKTLPVAGQNAFPCYDREGLMRLVETSKPRNDPDHHCFSFFAFQQPSPLVQSAICISELDYFIKSMHGEIINNVES