Gene Details:

Protein Features:

Annotation Proteins:

  • Refseq:  XP_023879306.1  — BES1/BZR1 homolog protein 4-like isoform X1
  • Refseq:  XP_023879307.1  — BES1/BZR1 homolog protein 4-like isoform X2
  • Swissprot:  Q9ZV88  — BEH4_ARATH; BES1/BZR1 homolog protein 4
  • TrEMBL:  A0A2N9IIT0  — A0A2N9IIT0_FAGSY; Uncharacterized protein
  • STRING:  XP_009352718.1  — (Pyrus x bretschneideri)

Family Introduction:

  • Brassinosteroids (BRs) signal through a plasma membrane-localized receptor kinase to regulate plant growth and development. We showed previously that a novel protein, BES1(BRI1-EMS-SUPPRESSOR 1), accumulates in the nucleus in response to BRs, where it plays a role in BR-regulated gene expression; however, the mechanism by which BES1 regulates gene expression is unknown. In this study, we dissect BES1 subdomains and establish that BES1 is a transcription factor that binds to and activates BR target gene promoters both in vitro and in vivo.
  • BES1 interacts with a basic helix-loop-helix protein, BIM1, to synergistically bind to E box (CANNTG) sequences present in many BR-induced promoters. Loss-of-function and gain-of-function mutants of BIM1 and its close family members display BR response phenotypes. Thus, BES1 defines a new class of plant-specific transcription factors that cooperate with transcription factors such as BIM1 to regulate BR-induced genes.

Literature:

Sequences:

CDS Sequence:
  • >maker-scaffold00766-augustus-gene-0.35-mRNA-1|Castanea_mollissima|BES1|maker-scaffold00766-augustus-gene-0.35-mRNA-1
Protein Sequence:
  • >maker-scaffold00766-augustus-gene-0.35-mRNA-1|Castanea_mollissima|BES1|maker-scaffold00766-augustus-gene-0.35-mRNA-1
    MTSGTRMPTWKERENNKRRERRRRAIAAKIYAGLRMYGNYKLPKHCDNNEVLKALCNEAGWTVEEDGTTYRKGCKPVDRMDIMGGSTSASPCSSYQPSPCASYNPSPGSSSFPSPVSSRYAANAKGNADADSLIPWLKNLSSSSSSASSKLPYHLNVHGGSISAPVTPPLSSPTARTPRTKNDWDDPTVAPSWAGQHYSFLPSSTPPSPGRQGLPDSRWLAGIQIPQSGPSSPTFSLVSPNPFGFMEEAFSGGGSRMWTPGQSGTCSPAIPAGIDHTSDVPMSDGIAAEFAFGSNTTGLVKPWEGERIHEECVSDDLELTLGSSRTR