Gene Details:
- Gene ID: KHN36916.1
- Gene Family: BES1 Family
- Description: BES1 Family protein
- Species: Glycine soja
- Source: BES1 family gene from PlantTFDB
Protein Features:
Annotation Proteins:
- Refseq: XP_003543196.1 — BES1/BZR1 homolog protein 4 isoform X1
- Refseq: XP_006594721.1 — BES1/BZR1 homolog protein 4 isoform X2
- Refseq: XP_028190417.1 — BES1/BZR1 homolog protein 4-like isoform X1
- Refseq: XP_028190418.1 — BES1/BZR1 homolog protein 4-like isoform X2
- Swissprot: Q5Z9E5 — BZR3_ORYSJ; Protein BZR1 homolog 3
- TrEMBL: A0A445IAK8 — A0A445IAK8_GLYSO; BES1/BZR1-like protein 4 isoform A
- TrEMBL: A0A445IB09 — A0A445IB09_GLYSO; BES1/BZR1-like protein 4 isoform B
- TrEMBL: I1M2X8 — I1M2X8_SOYBN; Uncharacterized protein
- TrEMBL: I1M2Y0 — I1M2Y0_SOYBN; Uncharacterized protein
- STRING: GLYMA13G34180.1 — (Glycine max)
Gene Ontology:
- GO:0006355 — Biological Process — regulation of transcription, DNA-templated
Family Introduction:
- Brassinosteroids (BRs) signal through a plasma membrane-localized receptor kinase to regulate plant growth and development. We showed previously that a novel protein, BES1(BRI1-EMS-SUPPRESSOR 1), accumulates in the nucleus in response to BRs, where it plays a role in BR-regulated gene expression; however, the mechanism by which BES1 regulates gene expression is unknown. In this study, we dissect BES1 subdomains and establish that BES1 is a transcription factor that binds to and activates BR target gene promoters both in vitro and in vivo.
- BES1 interacts with a basic helix-loop-helix protein, BIM1, to synergistically bind to E box (CANNTG) sequences present in many BR-induced promoters. Loss-of-function and gain-of-function mutants of BIM1 and its close family members display BR response phenotypes. Thus, BES1 defines a new class of plant-specific transcription factors that cooperate with transcription factors such as BIM1 to regulate BR-induced genes.
Literature:
- A new class of transcription factors mediates brassinosteroid-regulated gene expression in Arabidopsis. DOI: 10.1016/j.cell.2004.11.044 ; PMID: 15680330
Sequences:
CDS Sequence:
- >KHN36916.1|Glycine_soja|BES1|KHN36916.1
ATGACGTCCGTCGCGAGGCAGCCAACGTGGAAGGAGCGGGAGAACAACAAGAGGCGAGAGAGGAGGAGGAGAGCCATCGCGGCGAAGATCTTCTCCGGCCTGCGAATGTACGGCAACTACAAGCTCCCCAAACACTGCGACAACAACGAAGTTCTCAAGGCTCTCTGCAACGAAGCCGGCTGGACCGTAGAAGCCGATGGCACCACCTATCGCAAGTGGCATGGCACATGCTACTGGTGGTGGGAATCAGAAGGACGCGAAAGGCGCAGGGAGTTACGGAAAGGATGA
Protein Sequence:
- >KHN36916.1|Glycine_soja|BES1|KHN36916.1
MTSVARQPTWKERENNKRRERRRRAIAAKIFSGLRMYGNYKLPKHCDNNEVLKALCNEAGWTVEADGTTYRKWHGTCYWWWESEGRERRRELRKG