Gene Details:

  • Gene ID: GSVIVT01014154001
  • Gene Family: BES1 Family
  • Description: BES1 Family protein
  • Species: Vitis vinifera
  • Source: BES1 family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_010644097.1  — PREDICTED: BES1/BZR1 homolog protein 4
  • Swissprot:  Q9ZV88  — BEH4_ARATH; BES1/BZR1 homolog protein 4
  • TrEMBL:  A0A067DLE1  — A0A067DLE1_CITSI; Uncharacterized protein
  • TrEMBL:  A0A2H5Q4X7  — A0A2H5Q4X7_CITUN; Uncharacterized protein
  • TrEMBL:  F6H1V6  — F6H1V6_VITVI; Uncharacterized protein
  • TrEMBL:  V4TV52  — V4TV52_9ROSI; Uncharacterized protein
  • STRING:  XP_006477843.1  — (Citrus sinensis)
  • STRING:  VIT_19s0014g00870.t01  — (Vitis vinifera)
  • STRING:  XP_006442380.1  — (Citrus clementina)

Family Introduction:

  • Brassinosteroids (BRs) signal through a plasma membrane-localized receptor kinase to regulate plant growth and development. We showed previously that a novel protein, BES1(BRI1-EMS-SUPPRESSOR 1), accumulates in the nucleus in response to BRs, where it plays a role in BR-regulated gene expression; however, the mechanism by which BES1 regulates gene expression is unknown. In this study, we dissect BES1 subdomains and establish that BES1 is a transcription factor that binds to and activates BR target gene promoters both in vitro and in vivo.
  • BES1 interacts with a basic helix-loop-helix protein, BIM1, to synergistically bind to E box (CANNTG) sequences present in many BR-induced promoters. Loss-of-function and gain-of-function mutants of BIM1 and its close family members display BR response phenotypes. Thus, BES1 defines a new class of plant-specific transcription factors that cooperate with transcription factors such as BIM1 to regulate BR-induced genes.

Literature:

Sequences:

CDS Sequence:
  • >GSVIVT01014154001|Vitis_vinifera|BES1|GSVIVT01014154001
    ATGACGTCGGGGGCGAGGCTGCCGACATGGAAGGAGAGGGAGAACAACAAGAGGAGAGAGCGGCGGAGGAGGGCCATCGCGGCGAAGATTTTCGCCGGACTGAGAATGTACGGAAACTACAAGCTCCCCAAGCACTGCGACAACAACGAAGTCCTCAAAGCCCTTTGCAACGAGGCCGGATGGACCGTCGAGCCCGACGGCACCACCTACCGGAAGGGATGCAAGCCTGTTGAACGCATGGACATTGTGGGTGGATCCGCATCAGCAAGCCCGTGCTCATCTTATCACCCAAGCCCTTCTTCCCCATCTATACATCCATAG
Protein Sequence:
  • >GSVIVT01014154001|Vitis_vinifera|BES1|GSVIVT01014154001
    MTSGARLPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCNEAGWTVEPDGTTYRKGCKPVERMDIVGGSASASPCSSYHPSPSSPSIHP*