Gene Details:

  • Gene ID: Gh_Sca033106G01
  • Gene Family: BES1 Family
  • Description: BES1 Family protein
  • Species: Gossypium hirsutum
  • Source: BES1 family gene from PlantTFDB

Protein Features:

Annotation Proteins:

Family Introduction:

  • Brassinosteroids (BRs) signal through a plasma membrane-localized receptor kinase to regulate plant growth and development. We showed previously that a novel protein, BES1(BRI1-EMS-SUPPRESSOR 1), accumulates in the nucleus in response to BRs, where it plays a role in BR-regulated gene expression; however, the mechanism by which BES1 regulates gene expression is unknown. In this study, we dissect BES1 subdomains and establish that BES1 is a transcription factor that binds to and activates BR target gene promoters both in vitro and in vivo.
  • BES1 interacts with a basic helix-loop-helix protein, BIM1, to synergistically bind to E box (CANNTG) sequences present in many BR-induced promoters. Loss-of-function and gain-of-function mutants of BIM1 and its close family members display BR response phenotypes. Thus, BES1 defines a new class of plant-specific transcription factors that cooperate with transcription factors such as BIM1 to regulate BR-induced genes.

Literature:

Sequences:

CDS Sequence:
  • >Gh_Sca033106G01|Gossypium_hirsutum|BES1|Gh_Sca033106G01
    ATGAACGATGTGCTAGCCGCCTTGGCCCGTGAGGCTGGTTGGACCGTTGAGCCTGACGGCACTACTTACAGGCACTCTCCACCTCCCCAACATCAACAACATTTGGGAGCATTTTCGGTAAGGTCAGGTGAAAGTCCACTATCGGCTACTTCTTTGAAGAACTGCTCTGTTAAAGCAACGTTAGACTGTCAGCAACCTGTCGTCAGAATTGATGGCAGTTTGTCTCCAGCATCTCTTGATTCCGTTGTTATAGCTGAGAGAGATACACGGAGTGAGAAATATCCAAGTACTAGTCCTATCAACTCAGTTGAGTGCCTGGAGGCAGATCAG
Protein Sequence:
  • >Gh_Sca033106G01|Gossypium_hirsutum|BES1|Gh_Sca033106G01
    MNDVLAALAREAGWTVEPDGTTYRHSPPPQHQQHLGAFSVRSGESPLSATSLKNCSVKATLDCQQPVVRIDGSLSPASLDSVVIAERDTRSEKYPSTSPINSVECLEADQ