Gene Details:

  • Gene ID: Rsa1.0_00944.1_g00011.1
  • Gene Family: BBR-BPC Family
  • Description: BBR-BPC Family protein
  • Species: Raphanus sativus
  • Source: BBR-BPC family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_018447695.1  — PREDICTED: protein BASIC PENTACYSTEINE5-like
  • Refseq:  XP_018447854.1  — PREDICTED: protein BASIC PENTACYSTEINE5-like
  • Swissprot:  F4JUI3  — BPC5_ARATH; Protein BASIC PENTACYSTEINE5
  • TrEMBL:  A0A3P6C5P1  — A0A3P6C5P1_BRACM; Uncharacterized protein
  • STRING:  XP_006411681.1  — (Eutrema salsugineum)

Gene Ontology:

  • GO:0006355  — Biological Process — regulation of transcription, DNA-templated
  • GO:0005634  — Cellular Component — nucleus
  • GO:0003677  — Molecular Function — DNA binding
  • GO:0003700  — Molecular Function — transcription factor activity, sequence-specific DNA binding

Family Introduction:

  • We identified BASIC PENTACYSTEINE1 (BPC1) as a regulator of the homeotic Arabidopsis thaliana gene SEEDSTICK (STK), which controls ovule identity, and characterized its mechanism of action. A combination of tethered particle motion analysis and electromobility shift assays revealed that BPC1 is able to induce conformational changes by cooperative binding to purine-rich elements present in the STK regulatory sequence. Analysis of STK expression in the bpc1 mutant showed that STK is upregulated. Our results give insight into the regulation of gene expression in plants and provide the basis for further studies to understand the mechanisms that control ovule identity in Arabidopsis.
  • BBR is nuclear targeted and is a characterized nuclear localization signal (NLS) sequence, a DNA-binding domain extended up to 90 aa at the C-terminus and a putative N-terminal activation domain. The corresponding gene has no introns and is ubiquitously expressed in barley tissues. In co-transfection experiments, BBR activates (GA/TC)8-containing promoters, and its overexpression in tobacco leads to a pronounced leaf shape modification. BBR has properties of a GAGA-binding factor, but the corresponding gene has no sequence homology to Trl and Psq of Drosophila, which encode functionally analogous proteins. In Arabidopsis, (GA/TC)8 repeats occur particularly within 1500 bp upstream of gene start codons included in some homeodomain genes of different classes. The data presented suggest that expression of the barley BKn3 is regulated, at least in part, by the binding of the transcription factor BBR to GA/TC repeats.

Literature:

Sequences:

CDS Sequence:
  • >Rsa1.0_00944.1_g00011.1|Raphanus_sativus|BBR-BPC|Rsa1.0_00944.1_g00011.1
    ATGGAGAGTGGTGGCCAGTATGATAATGGGCGGTACAAGCCTGATTACTTCAAAGGGACACCACCTTCTGTGTGGAATATAATGCCTCAGCATCAGATAAAGGAGCAGCATAATGCCCTCGTCATGAACAAGAAGATCATGTCCATCCTCGCCGAGAGAGACTCTGCTCTCAAGGAACGAAACGAAGCCGTAGCTGCCAAGAAGGAAGCTTTAGCCGCTCGTGACGAAGCACTCGAGCAACGGGACAGAGCTCTCTCCGAAAGAGACAATGCCATCATGGAGAGGGAAACTGCGTTGAATGCTCTTCACTACCCTGAGAACAACTTAAACCATCACATTCTGTCACGTGGTGGAAATGAAGGAACCCACCTACCGAACCCTTCCCCTCCATCAACTATTCCAGCCGACAAGAAGCCCACCAAAAGGAAAAAAGAGAGCAAACAGGGAAAAGACCTGAACCGTCTGGTCGCTTCTCCCGGGAAGAAGTGCAGAAAAGATTGGGACGTTAACGACGTCGGTTTAAATCTACTCGCGTTCGACGAGACGTCGATGCCAGTGCCCGTGTGCACTTGCACGGGCACTGCTCGTCAGTGTTACAAATGGGGAAGCGGCGGGTGGCAGTCGTCTTGCTGCACGACCACATTGTCTCAGCATCCTCTCCCGCAGATGCCGAACAAGCGGCATTCTCGGATGGGTGGTAGGAAGATGAGCGGGAACGTCTTCTCCAGGTTACTTAGCCGTTTAGCTGGCGAAGGGCACGACCTCTCCTCTCCCGTTGATCTCAAGGACTATTGGGCTAGGCACGGTACGAATCGGTACATCACTATCAAGTAG
Protein Sequence:
  • >Rsa1.0_00944.1_g00011.1|Raphanus_sativus|BBR-BPC|Rsa1.0_00944.1_g00011.1
    MESGGQYDNGRYKPDYFKGTPPSVWNIMPQHQIKEQHNALVMNKKIMSILAERDSALKERNEAVAAKKEALAARDEALEQRDRALSERDNAIMERETALNALHYPENNLNHHILSRGGNEGTHLPNPSPPSTIPADKKPTKRKKESKQGKDLNRLVASPGKKCRKDWDVNDVGLNLLAFDETSMPVPVCTCTGTARQCYKWGSGGWQSSCCTTTLSQHPLPQMPNKRHSRMGGRKMSGNVFSRLLSRLAGEGHDLSSPVDLKDYWARHGTNRYITIK