Gene Details:

Protein Features:

Annotation Proteins:

  • Refseq:  XP_025827829.1  — B3 domain-containing protein Os11g0156000-like isoform X1
  • Swissprot:  Q53QI0  — Y1160_ORYSJ; B3 domain-containing protein Os11g0156000
  • TrEMBL:  A0A3L6PJV1  — A0A3L6PJV1_PANMI; Uncharacterized protein
  • STRING:  Sb05g003450.1  — (Sorghum bicolor)

Gene Ontology:

  • GO:0080113  — Biological Process — regulation of seed growth
  • GO:0005634  — Cellular Component — nucleus
  • GO:0003700  — Molecular Function — transcription factor activity, sequence-specific DNA binding
  • GO:0043565  — Molecular Function — sequence-specific DNA binding
  • GO:0044212  — Molecular Function — transcription regulatory region DNA binding

Family Introduction:

  • The plant-specific B3 superfamily encompasses well-characterized families, such as the auxin response factor (ARF) family and the LAV family, as well as less well understood families, such as RAV and REM.
  • All members of the B3 superfamily contain an ~ 110 amino acid region called the B3 domain. This domain was initially named because it was the third basic domain in the maize gene VIVIPAROUS1 (VP1).
  • The first and second basic domains (B1 and B2) are specific to the VP1-like proteins, but genes that contain the B3 domain are widespread in plant genomes. The B3 domain of VP1 encodes a sequence-specific DNA binding activity.

Literature:

Sequences:

CDS Sequence:
  • >Zpz_sc03363.1.g00060.1.am.mk|Zoysia_pacifica|B3|Zpz_sc03363.1.g00060.1.am.mk
Protein Sequence:
  • >Zpz_sc03363.1.g00060.1.am.mk|Zoysia_pacifica|B3|Zpz_sc03363.1.g00060.1.am.mk
    MAMNHISQEHPQVWPWGVAMYTNLHYHHHYEKEHLFEKPLTPSDVGKLNRLVIPKQHAERYFPLSGDSGEKGLILSFEDEAGKPWRFRYSYWTSSQSYVLTKGWSRYVKEKHLDAGDVVHFERMRGLGIGDRLFIGFRRRGESATTRAVAPPLPAVRVAAAAQSAGEQQPWSPMCYSTSGSYPNSPANSYAYRHSVDHDRSNTPHAGESSAASVPSRRLRLFGVNLDCGPEPEAETPTAMYGSYMQQSPTFPEPNTWSALQNQSN