Gene Details:

Protein Features:

Annotation Proteins:

  • Refseq:  XP_020398137.1  — AP2/ERF and B3 domain-containing protein Os01g0693400 isoform X2
  • Swissprot:  Q8RZX9  — Y1934_ORYSJ; AP2/ERF and B3 domain-containing protein Os01g0693400
  • TrEMBL:  A0A3L6FN24  — A0A3L6FN24_MAIZE; AP2/ERF and B3 domain-containing protein
  • STRING:  Pavir.Eb02845.1.p  — (Panicum virgatum)

Gene Ontology:

  • GO:0006355  — Biological Process — regulation of transcription, DNA-templated
  • GO:0003677  — Molecular Function — DNA binding
  • GO:0003700  — Molecular Function — transcription factor activity, sequence-specific DNA binding

Family Introduction:

  • The plant-specific B3 superfamily encompasses well-characterized families, such as the auxin response factor (ARF) family and the LAV family, as well as less well understood families, such as RAV and REM.
  • All members of the B3 superfamily contain an ~ 110 amino acid region called the B3 domain. This domain was initially named because it was the third basic domain in the maize gene VIVIPAROUS1 (VP1).
  • The first and second basic domains (B1 and B2) are specific to the VP1-like proteins, but genes that contain the B3 domain are widespread in plant genomes. The B3 domain of VP1 encodes a sequence-specific DNA binding activity.

Literature:

Sequences:

CDS Sequence:
  • >Zpz_sc00444.1.g00210.1.am.mk|Zoysia_pacifica|B3|Zpz_sc00444.1.g00210.1.am.mk
Protein Sequence:
  • >Zpz_sc00444.1.g00210.1.am.mk|Zoysia_pacifica|B3|Zpz_sc00444.1.g00210.1.am.mk
    MLPSASICPRGLVTGLGGVVLASAETTTLASPPTHRRGYISPCIPRSPVHSIPTLQTSSFSDRSIIEFVSSYLVVVHTHTLEMDSASSLVEDTGGGGGGGTSTDKLRALAAVVAVGPPLERVGSGASGIYERHQRVWLGTFAGEADAARAYDVAAQRFRGRDAVTNFRPLADADPNAAAELRFLASRSKAEVVDMLRKHTYFDELAQNRRAFAASAPTTTSSPLAGDHAAGSSLRPSPVAAREHLFDKTVTPSDVGKLNRLVIPKQHAEKHFPLQLPSAGGESKGVLLNFEDAGGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKGLNAGDVVGFYRSAESDVADSKLFIDCKLRPNNTTAASMATPVTAVRLFGVDLLTAPTPESAMAGCKRARDFAATPPQAVFKKPLVELALV