Gene Details:

Protein Features:

Annotation Proteins:

  • Refseq:  XP_002447504.2  — putative B3 domain-containing protein Os04g0346900
  • Refseq:  XP_008663075.1  — putative B3 domain-containing protein Os04g0347400 isoform X2
  • TrEMBL:  A0A1D6J4B1  — A0A1D6J4B1_MAIZE; Uncharacterized protein
  • TrEMBL:  A0A1Z5RBP1  — A0A1Z5RBP1_SORBI; Uncharacterized protein
  • TrEMBL:  A0A1Z5RCL3  — A0A1Z5RCL3_SORBI; Uncharacterized protein
  • TrEMBL:  A0A3L6GCJ2  — A0A3L6GCJ2_MAIZE; Putative B3 domain-containing protein
  • STRING:  Si010155m  — (Setaria italica)
  • STRING:  Sb06g002075.1  — (Sorghum bicolor)

Gene Ontology:

  • GO:0003677  — Molecular Function — DNA binding

Family Introduction:

  • The plant-specific B3 superfamily encompasses well-characterized families, such as the auxin response factor (ARF) family and the LAV family, as well as less well understood families, such as RAV and REM.
  • All members of the B3 superfamily contain an ~ 110 amino acid region called the B3 domain. This domain was initially named because it was the third basic domain in the maize gene VIVIPAROUS1 (VP1).
  • The first and second basic domains (B1 and B2) are specific to the VP1-like proteins, but genes that contain the B3 domain are widespread in plant genomes. The B3 domain of VP1 encodes a sequence-specific DNA binding activity.

Literature:

Sequences:

CDS Sequence:
  • >Zmw_sc06737.1.g00010.1|Zoysia_matrella|B3|Zmw_sc06737.1.g00010.1
Protein Sequence:
  • >Zmw_sc06737.1.g00010.1|Zoysia_matrella|B3|Zmw_sc06737.1.g00010.1
    MAEHFKMLLSPPIERPVSITPRPLTILKRRHSTPLTELNRPADPIILVLQRVADELAGCFAVADGVPALVALVVSPFGSKVWRVEVGRDGEGAFLGRGWPEFLAAHGIGVDWFVVLRHEGGATLTVKAFDASFCIKEFRAPAE