Gene Details:

Protein Features:

Annotation Proteins:

  • Refseq:  XP_015888018.1  — B3 domain-containing protein Os07g0563300-like
  • Refseq:  XP_016445999.1  — PREDICTED: B3 domain-containing protein Os07g0563300-like isoform X2
  • Swissprot:  Q5CCK4  — VAL2_ARATH; B3 domain-containing transcription repressor VAL2
  • TrEMBL:  A0A0A8Y1C9  — A0A0A8Y1C9_ARUDO; Uncharacterized protein
  • TrEMBL:  A0A2P2MA13  — A0A2P2MA13_RHIMU; B3 domain-containing protein Os07g0563300-like
  • TrEMBL:  A0A453BAW7  — A0A453BAW7_AEGTS; Uncharacterized protein
  • TrEMBL:  W9SRZ6  — W9SRZ6_9ROSA; B3 domain-containing protein
  • STRING:  XP_010109656.1  — (Morus notabilis)

Gene Ontology:

  • GO:0003677  — Molecular Function — DNA binding

Family Introduction:

  • The plant-specific B3 superfamily encompasses well-characterized families, such as the auxin response factor (ARF) family and the LAV family, as well as less well understood families, such as RAV and REM.
  • All members of the B3 superfamily contain an ~ 110 amino acid region called the B3 domain. This domain was initially named because it was the third basic domain in the maize gene VIVIPAROUS1 (VP1).
  • The first and second basic domains (B1 and B2) are specific to the VP1-like proteins, but genes that contain the B3 domain are widespread in plant genomes. The B3 domain of VP1 encodes a sequence-specific DNA binding activity.

Literature:

Sequences:

CDS Sequence:
  • >Zmw_sc04973.1.g00090.1|Zoysia_matrella|B3|Zmw_sc04973.1.g00090.1
Protein Sequence:
  • >Zmw_sc04973.1.g00090.1|Zoysia_matrella|B3|Zmw_sc04973.1.g00090.1
    MEEKMNLSLQGEWEYQMLLQMLSASDAGRIGRLVLPKKCAEAYFPPISQPEGLPLKVQDINGKEWLFQFRYWPNNNSR