Gene Details:
- Gene ID: Zmw_sc03225.1.g00090.1
- Gene Family: B3 Family
- Description: B3 Family protein
- Species: Zoysia matrella
- Source: B3 family gene from PlantTFDB
Protein Features:
- PROSITE profile: PS50863
- SMART: SM01019
- SuperFamily: SSF101936
- Pfam: PF02362
- Gene3D: G3DSA:2.40.330.10
- InterPro: IPR003340 IPR015300
Annotation Proteins:
- Refseq: XP_021315059.1 — auxin response factor 6 isoform X2
- Swissprot: A2X1A1 — ARFF_ORYSI; Auxin response factor 6
- Swissprot: Q6H6V4 — ARFF_ORYSJ; Auxin response factor 6
- TrEMBL: A0A453NF79 — A0A453NF79_AEGTS; Auxin response factor
- STRING: evm.model.supercontig_17.53 — (Carica papaya)
- STRING: MLOC_66152.2 — (Hordeum vulgare)
- STRING: Sb04g004430.1 — (Sorghum bicolor)
Gene Ontology:
- GO:0003677 — Molecular Function — DNA binding
Family Introduction:
- The plant-specific B3 superfamily encompasses well-characterized families, such as the auxin response factor (ARF) family and the LAV family, as well as less well understood families, such as RAV and REM.
- All members of the B3 superfamily contain an ~ 110 amino acid region called the B3 domain. This domain was initially named because it was the third basic domain in the maize gene VIVIPAROUS1 (VP1).
- The first and second basic domains (B1 and B2) are specific to the VP1-like proteins, but genes that contain the B3 domain are widespread in plant genomes. The B3 domain of VP1 encodes a sequence-specific DNA binding activity.
Literature:
Sequences:
CDS Sequence:
- >Zmw_sc03225.1.g00090.1|Zoysia_matrella|B3|Zmw_sc03225.1.g00090.1
Protein Sequence:
- >Zmw_sc03225.1.g00090.1|Zoysia_matrella|B3|Zmw_sc03225.1.g00090.1
MEAQIPNYPSLPPQLICQLHNVTMHADAETDEVYAQMTLQPLSPQELKDSFLPADLGTTSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPAQELIAKDLHGNEWKFRHIFRGQPKRHLLTTGWSVFVNAKRLVAGDSVLFAWNENNQLLLGIRRANRPQTVMPSSVLSSDSMHIG