Gene Details:

Protein Features:

Annotation Proteins:

  • Refseq:  XP_023878122.1  — B3 domain-containing protein At2g36080-like isoform X1
  • Swissprot:  Q9FNI3  — Y5625_ARATH; B3 domain-containing protein At5g06250
  • TrEMBL:  A0A2N9F8Y0  — A0A2N9F8Y0_FAGSY; Uncharacterized protein
  • STRING:  VIT_08s0007g02810.t01  — (Vitis vinifera)

Gene Ontology:

  • GO:0010073  — Biological Process — meristem maintenance
  • GO:0010358  — Biological Process — leaf shaping
  • GO:0045892  — Biological Process — negative regulation of transcription, DNA-templated
  • GO:0003677  — Molecular Function — DNA binding

Family Introduction:

  • The plant-specific B3 superfamily encompasses well-characterized families, such as the auxin response factor (ARF) family and the LAV family, as well as less well understood families, such as RAV and REM.
  • All members of the B3 superfamily contain an ~ 110 amino acid region called the B3 domain. This domain was initially named because it was the third basic domain in the maize gene VIVIPAROUS1 (VP1).
  • The first and second basic domains (B1 and B2) are specific to the VP1-like proteins, but genes that contain the B3 domain are widespread in plant genomes. The B3 domain of VP1 encodes a sequence-specific DNA binding activity.

Literature:

Sequences:

CDS Sequence:
  • >snap_masked-scaffold00728-abinit-gene-0.19-mRNA-1|Castanea_mollissima|B3|snap_masked-scaffold00728-abinit-gene-0.19-mRNA-1
Protein Sequence:
  • >snap_masked-scaffold00728-abinit-gene-0.19-mRNA-1|Castanea_mollissima|B3|snap_masked-scaffold00728-abinit-gene-0.19-mRNA-1
    MFRNPNTPFNFNLNDENDNDEDLDDQNPTSQPQEFEQQQQQQPDDHQENEEAAAQQKEHMFEKPLTPSDVGKLNRLVIPKQHAEKYFPLGGDSSDKGLLLSFEDESGKCWRFRYSYWNSSQSYVLTKGWSRYVKEKRLDAGDVVLFERHRTDCDRLFIGWRRRGSVAAHDSSCGAGGSGGGVVAHNSTTTSACASGAVSEAWTRAFYNTHPYPTHHHHHHQQHHSQPLPYQPDSCLHAAESSSSQVENQTTPVGNSKILRLFGVNLECQTEDESVPSVLPDNDHNHASSTYQHYYHHQHDYSSSVPHDHMVRY