Gene Details:

Protein Features:

Annotation Proteins:

  • Refseq:  XP_009613660.1  — PREDICTED: putative B3 domain-containing protein Os03g0621600 isoform X1
  • Refseq:  XP_009613661.1  — PREDICTED: B3 domain-containing protein Os03g0619600-like isoform X3
  • Refseq:  XP_016490738.1  — PREDICTED: putative B3 domain-containing protein Os03g0621600 isoform X1
  • Refseq:  XP_016490744.1  — PREDICTED: putative B3 domain-containing protein Os03g0621600 isoform X2
  • Refseq:  XP_016490750.1  — PREDICTED: B3 domain-containing protein Os03g0619600-like isoform X3
  • Refseq:  XP_018629844.1  — PREDICTED: putative B3 domain-containing protein Os03g0621600 isoform X2
  • TrEMBL:  A0A0V0HLZ2  — A0A0V0HLZ2_SOLCH; Putative B3 domain-containing protein-like (Fragment)
  • STRING:  XP_009613660.1  — (Nicotiana tomentosiformis)
  • STRING:  PGSC0003DMT400043852  — (Solanum tuberosum)

Gene Ontology:

  • GO:0003677  — Molecular Function — DNA binding

Family Introduction:

  • The plant-specific B3 superfamily encompasses well-characterized families, such as the auxin response factor (ARF) family and the LAV family, as well as less well understood families, such as RAV and REM.
  • All members of the B3 superfamily contain an ~ 110 amino acid region called the B3 domain. This domain was initially named because it was the third basic domain in the maize gene VIVIPAROUS1 (VP1).
  • The first and second basic domains (B1 and B2) are specific to the VP1-like proteins, but genes that contain the B3 domain are widespread in plant genomes. The B3 domain of VP1 encodes a sequence-specific DNA binding activity.

Literature:

Sequences:

CDS Sequence:
  • >Peinf101Scf00925g20018.1|Petunia_inflata|B3|Peinf101Scf00925g20018.1
    ATGCAAGAGCAACTATCCAAGATTGCTTATGATTGGAACCAGAAAGTAAGGGACAAAGTAGTGTCTGCAGCATATCAAAGAGCAAATTCATATGCTTTAAAATCTAAGAATCCATTCCTTGTAACTTTTATGCAACAATCCTATGTCTCCGAACCGTACACTCTGGGCATAAAGATCACATTTGCTAGGAAATATTTCGAAGAGAACTACAACTATTTAATGCTTCGTGTTCATGGCAGGGGATCTTGGCCTGTTAAATGCTATCGAGGAACCAAGACAGCTAGAATTACTACTGGCTGGAAGGTATTTGTGTTGGACAACAAATTAAAATGTGGTGATGCTTGTGTATTTGAAGTGATCAAAGGCACTGATCAACTGTTTATCGATGTCGCTATATTTCGTGAAGATGGGAACACGCCCAATATGTGCTGA
Protein Sequence:
  • >Peinf101Scf00925g20018.1|Petunia_inflata|B3|Peinf101Scf00925g20018.1
    MQEQLSKIAYDWNQKVRDKVVSAAYQRANSYALKSKNPFLVTFMQQSYVSEPYTLGIKITFARKYFEENYNYLMLRVHGRGSWPVKCYRGTKTARITTGWKVFVLDNKLKCGDACVFEVIKGTDQLFIDVAIFREDGNTPNMC