Gene Details:

  • Gene ID: Pahal.I02533.4
  • Gene Family: B3 Family
  • Description: B3 Family protein
  • Species: Panicum hallii
  • Source: B3 family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_025796316.1  — putative B3 domain-containing protein Os03g0621600 isoform X1
  • Refseq:  XP_025796317.1  — putative B3 domain-containing protein Os03g0621600 isoform X1
  • Refseq:  XP_025796318.1  — putative B3 domain-containing protein Os03g0621600 isoform X1
  • Refseq:  XP_025796319.1  — putative B3 domain-containing protein Os03g0621600 isoform X2
  • Swissprot:  Q851V5  — Y3216_ORYSJ; Putative B3 domain-containing protein Os03g0621600
  • TrEMBL:  A0A2S3IK40  — A0A2S3IK40_9POAL; Uncharacterized protein
  • STRING:  Pavir.Ib03968.1.p  — (Panicum virgatum)

Gene Ontology:

  • GO:0009909  — Biological Process — regulation of flower development
  • GO:0010048  — Biological Process — vernalization response
  • GO:0005654  — Cellular Component — nucleoplasm
  • GO:0003677  — Molecular Function — DNA binding

Family Introduction:

  • The plant-specific B3 superfamily encompasses well-characterized families, such as the auxin response factor (ARF) family and the LAV family, as well as less well understood families, such as RAV and REM.
  • All members of the B3 superfamily contain an ~ 110 amino acid region called the B3 domain. This domain was initially named because it was the third basic domain in the maize gene VIVIPAROUS1 (VP1).
  • The first and second basic domains (B1 and B2) are specific to the VP1-like proteins, but genes that contain the B3 domain are widespread in plant genomes. The B3 domain of VP1 encodes a sequence-specific DNA binding activity.

Literature:

Sequences:

CDS Sequence:
  • >Pahal.I02533.4|Panicum_hallii|B3|Pahal.I02533.4
    ATGGACGATCGATGCAAGTACTTCTTCAAGGTTATGATGGGTGATTTTCGAAGTCGAATGACCATACCAGACAAATTTGCACAGCGTTTTAGGGATAAGATCCGAGGAAAGATAAAGTTGAAAGTGTATAATGGAAGCACTTGCACTGTTGTAGTTGCCAGACATCGGAATAAGTTAGTTCTCGAAGCAGGATGGGAGGCATTTATCAGCACTCATGACATAAGGCTGGCTGACTTACTTGTATTCAGATACAATGGAAATTTTCAGTTTGAGGTTTTGGTCTTTGATCCAAGCTGTTGTGTGAAAGAGTCCTCAAATGTTGCTCAGAACTGTTGCGATCATGTCCAAGTCCAGCAAAGGCACAGAGATCTTCTTGACATTTCAAGCGACTCTGGTGATGACCAGGAGCCCATGCAATCATCAGGAAGTGAAGATCCAACTCCAGCTGAAAAGAAAGGCCCAAACCAGAGCACTAAGAAGACCAATACAAGTTCATTAACCTGCCACCTAAATGCACCTGGGCTTCTGTAG
Protein Sequence:
  • >Pahal.I02533.4|Panicum_hallii|B3|Pahal.I02533.4
    MDDRCKYFFKVMMGDFRSRMTIPDKFAQRFRDKIRGKIKLKVYNGSTCTVVVARHRNKLVLEAGWEAFISTHDIRLADLLVFRYNGNFQFEVLVFDPSCCVKESSNVAQNCCDHVQVQQRHRDLLDISSDSGDDQEPMQSSGSEDPTPAEKKGPNQSTKKTNTSSLTCHLNAPGLL*