Gene Details:

  • Gene ID: ONIVA06G00810.2
  • Gene Family: B3 Family
  • Description: B3 Family protein
  • Species: Oryza nivara
  • Source: B3 family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_015643738.1  — B3 domain-containing protein Os06g0112300
  • Refseq:  XP_015643739.1  — B3 domain-containing protein Os06g0112300
  • Refseq:  XP_025882046.1  — B3 domain-containing protein Os06g0112300
  • Swissprot:  Q9LHY9  — Y6112_ORYSJ; B3 domain-containing protein Os06g0112300
  • TrEMBL:  A0A0E0HJU6  — A0A0E0HJU6_ORYNI; Uncharacterized protein
  • TrEMBL:  A2Y8H3  — A2Y8H3_ORYSI; Uncharacterized protein
  • STRING:  ORUFI06G00790.1  — (Oryza rufipogon)
  • STRING:  OS06T0112300-01  — (Oryza sativa)

Gene Ontology:

  • GO:0000003  — Biological Process — reproduction
  • GO:0001944  — Biological Process — vasculature development
  • GO:0009116  — Biological Process — nucleoside metabolic process
  • GO:0019509  — Biological Process — L-methionine biosynthetic process from methylthioadenosine
  • GO:0003677  — Molecular Function — DNA binding
  • GO:0008930  — Molecular Function — methylthioadenosine nucleosidase activity

Family Introduction:

  • The plant-specific B3 superfamily encompasses well-characterized families, such as the auxin response factor (ARF) family and the LAV family, as well as less well understood families, such as RAV and REM.
  • All members of the B3 superfamily contain an ~ 110 amino acid region called the B3 domain. This domain was initially named because it was the third basic domain in the maize gene VIVIPAROUS1 (VP1).
  • The first and second basic domains (B1 and B2) are specific to the VP1-like proteins, but genes that contain the B3 domain are widespread in plant genomes. The B3 domain of VP1 encodes a sequence-specific DNA binding activity.

Literature:

Sequences:

CDS Sequence:
  • >ONIVA06G00810.2|Oryza_nivara|B3|ONIVA06G00810.2
    ATGGAGCTGGACACTGATCCTACCAAGCTGAAGGCCAAGCCCATCATCAAACCAAAAGTAGAACCCTGCGACGACGATGACGAGTTGCCGCCGCCGCCGCCGCCGCCGGCTTCAGGATCCGGCGAGGATTGGGAGGCCACCACCCCTCTCGCCGCCGGCAACCCCTTCTTCACCGCCCTCATCGCCAAGTCTCATCTCCACCCCAAGTTCCAGATGTGGATTCCACCTCGGTTCCAGCATCGGCTGGCGGAGCCGGAGGCGCGCACGGCGGCGGTGCTCCACTCCGGCGGCAAGTCGTGGGCGACGAGCTACTGCGGCCACCTCAAGATGAAGAAGCTGGACGCGGGATGGTCGGAGTTCGCGGTGGACAACCGGCTCCTGGTCGGGGACGCCTGCGTCTTCGAGCTCGTCGCCATGGGCGCCGCCGGAGGTCTGGAGTTCCAGGTGCAGATACTCCGCGGCGGCCTGCCGGCGGAGGTCGTCACCTCCAAGGGCCTCACCTCCGACCAACCCATCCTCATCGTCGACTAG
Protein Sequence:
  • >ONIVA06G00810.2|Oryza_nivara|B3|ONIVA06G00810.2
    MELDTDPTKLKAKPIIKPKVEPCDDDDELPPPPPPPASGSGEDWEATTPLAAGNPFFTALIAKSHLHPKFQMWIPPRFQHRLAEPEARTAAVLHSGGKSWATSYCGHLKMKKLDAGWSEFAVDNRLLVGDACVFELVAMGAAGGLEFQVQILRGGLPAEVVTSKGLTSDQPILIVD