Gene Details:

Protein Features:

Annotation Proteins:

  • Refseq:  XP_009612440.1  — PREDICTED: B3 domain-containing protein REM10-like isoform X2
  • Refseq:  XP_016494916.1  — PREDICTED: B3 domain-containing protein REM10-like isoform X1
  • Refseq:  XP_016494917.1  — PREDICTED: B3 domain-containing protein REM10-like isoform X2
  • Swissprot:  O81778  — REM9_ARATH; B3 domain-containing protein REM9
  • TrEMBL:  A0A1J6IAT2  — A0A1J6IAT2_NICAT; B3 domain-containing protein rem10 (Fragment)
  • TrEMBL:  A0A1S4C180  — A0A1S4C180_TOBAC; B3 domain-containing protein REM10-like isoform X1
  • TrEMBL:  A0A1S4C193  — A0A1S4C193_TOBAC; B3 domain-containing protein REM10-like isoform X2
  • STRING:  XP_009612433.1  — (Nicotiana tomentosiformis)

Gene Ontology:

  • GO:0003677  — Molecular Function — DNA binding

Family Introduction:

  • The plant-specific B3 superfamily encompasses well-characterized families, such as the auxin response factor (ARF) family and the LAV family, as well as less well understood families, such as RAV and REM.
  • All members of the B3 superfamily contain an ~ 110 amino acid region called the B3 domain. This domain was initially named because it was the third basic domain in the maize gene VIVIPAROUS1 (VP1).
  • The first and second basic domains (B1 and B2) are specific to the VP1-like proteins, but genes that contain the B3 domain are widespread in plant genomes. The B3 domain of VP1 encodes a sequence-specific DNA binding activity.

Literature:

Sequences:

CDS Sequence:
  • >Niben101Scf04748g03001.1|Nicotiana_benthamiana|B3|Niben101Scf04748g03001.1
Protein Sequence:
  • >Niben101Scf04748g03001.1|Nicotiana_benthamiana|B3|Niben101Scf04748g03001.1
    MTLDGKKWRVKVNGHRFEAGWAEFAEEHDLQLGDMLVFRHEGNMNFDVSIFGSSHYERICGVYARRRGGGDPQEI