Gene Details:
- Gene ID: Niben101Scf04748g02012.1
- Gene Family: B3 Family
- Description: B3 Family protein
- Species: Nicotiana benthamiana
- Source: B3 family gene from PlantTFDB
Protein Features:
- PROSITE profile: PS50863
- SMART: SM01019
- SuperFamily: SSF101936
- Pfam: PF02362
- Gene3D: G3DSA:2.40.330.10
- InterPro: IPR003340 IPR015300
Annotation Proteins:
- Refseq: XP_009781505.1 — PREDICTED: B3 domain-containing protein REM14-like isoform X1
- Refseq: XP_009781513.1 — PREDICTED: B3 domain-containing protein REM14-like isoform X1
- Refseq: XP_009781519.1 — PREDICTED: B3 domain-containing protein REM14-like isoform X1
- Refseq: XP_009781527.1 — PREDICTED: B3 domain-containing protein REM14-like isoform X1
- Refseq: XP_009781534.1 — PREDICTED: B3 domain-containing protein REM10-like isoform X2
- Refseq: XP_016454029.1 — PREDICTED: B3 domain-containing protein REM14-like isoform X1
- Refseq: XP_016454030.1 — PREDICTED: B3 domain-containing protein REM14-like isoform X1
- Refseq: XP_016454031.1 — PREDICTED: B3 domain-containing protein REM14-like isoform X1
- Refseq: XP_016454032.1 — PREDICTED: B3 domain-containing protein REM14-like isoform X1
- Refseq: XP_016454033.1 — PREDICTED: B3 domain-containing protein REM14-like isoform X1
- Refseq: XP_016454034.1 — PREDICTED: B3 domain-containing protein REM14-like isoform X1
- Refseq: XP_016454035.1 — PREDICTED: B3 domain-containing protein REM10-like isoform X2
- TrEMBL: A0A1S3YP65 — A0A1S3YP65_TOBAC; B3 domain-containing protein REM14-like isoform X1
- TrEMBL: A0A1S3YPX6 — A0A1S3YPX6_TOBAC; B3 domain-containing protein REM10-like isoform X2
- TrEMBL: A0A1U7X3S6 — A0A1U7X3S6_NICSY; B3 domain-containing protein REM14-like isoform X1
- TrEMBL: A0A1U7X3U2 — A0A1U7X3U2_NICSY; B3 domain-containing protein REM10-like isoform X2
- STRING: XP_009781505.1 — (Nicotiana sylvestris)
Gene Ontology:
- GO:0009507 — Cellular Component — chloroplast
- GO:0003677 — Molecular Function — DNA binding
Family Introduction:
- The plant-specific B3 superfamily encompasses well-characterized families, such as the auxin response factor (ARF) family and the LAV family, as well as less well understood families, such as RAV and REM.
- All members of the B3 superfamily contain an ~ 110 amino acid region called the B3 domain. This domain was initially named because it was the third basic domain in the maize gene VIVIPAROUS1 (VP1).
- The first and second basic domains (B1 and B2) are specific to the VP1-like proteins, but genes that contain the B3 domain are widespread in plant genomes. The B3 domain of VP1 encodes a sequence-specific DNA binding activity.
Literature:
Sequences:
CDS Sequence:
- >Niben101Scf04748g02012.1|Nicotiana_benthamiana|B3|Niben101Scf04748g02012.1
Protein Sequence:
- >Niben101Scf04748g02012.1|Nicotiana_benthamiana|B3|Niben101Scf04748g02012.1
MKVRPAKPQFFKPIQPGFKRALKIPNGFLKYLKGHEHEHAVLKRGSKKWLVKLNGQRLEEGWEKFAEEHDLRLGDLLIFRHEGEMEFQVTIFDSSHCDREYAEYLQDEEEAHIVKDPSKKFEITEAAPQNPIGQSHVVCTVRSYCFSKGYFRLPLKFTKANGFRNKKCGLIIRDERQRSWNLKLYTSCHHVYIGGRWAKFRAENDLKVGDRIVFEVVTNGERPIWKFHRLRKNASLQPKGKRTNSDNERVSSPEKPNSNIISSCKAVPNVEAAKDLHLGHPHFICTMKPYNLSKCFLRVPSTFARQHGLRDRKCTILIRDEQRSWTFTLYSCSMVTYIGGGWHNFCIANCLKEGDRVMFGIVANGEKPILKFHDLRDNASFRPEGKKTNSDTEKVSTQEKPKSNIISSRKAVPDVEAAKDMHLGQPHFISTMKPYYLSKRFLHVPSPFARQHGLRDGRCTIMIRDEQRSWTFKLYSCGRFTYIGGGWREFCIANFLKEGDRVMFEIVANGEKPILKFHG