Gene Details:

Protein Features:

Annotation Proteins:

  • Refseq:  XP_009774698.1  — PREDICTED: putative B3 domain-containing protein At3g49610
  • Refseq:  XP_016495804.1  — PREDICTED: putative B3 domain-containing protein At3g49610
  • TrEMBL:  A0A1S4C414  — A0A1S4C414_TOBAC; putative B3 domain-containing protein At3g49610
  • TrEMBL:  A0A1U7W7U3  — A0A1U7W7U3_NICSY; putative B3 domain-containing protein At3g49610
  • STRING:  XP_009774698.1  — (Nicotiana sylvestris)

Gene Ontology:

  • GO:0003677  — Molecular Function — DNA binding

Family Introduction:

  • The plant-specific B3 superfamily encompasses well-characterized families, such as the auxin response factor (ARF) family and the LAV family, as well as less well understood families, such as RAV and REM.
  • All members of the B3 superfamily contain an ~ 110 amino acid region called the B3 domain. This domain was initially named because it was the third basic domain in the maize gene VIVIPAROUS1 (VP1).
  • The first and second basic domains (B1 and B2) are specific to the VP1-like proteins, but genes that contain the B3 domain are widespread in plant genomes. The B3 domain of VP1 encodes a sequence-specific DNA binding activity.

Literature:

Sequences:

CDS Sequence:
  • >Niben101Scf02283g00017.1|Nicotiana_benthamiana|B3|Niben101Scf02283g00017.1
Protein Sequence:
  • >Niben101Scf02283g00017.1|Nicotiana_benthamiana|B3|Niben101Scf02283g00017.1
    MTRIKLFGKEIEVEEEPKTIKLFGARIYPCNVEKQQEQEAALQENLPPTNMCQAIRLAGGSGLVYIGRKKAEESDIKPDLSRLLIPGTFDKELLKNLSEEERIKLVDNDDTDKSFEVKVMDQEGNFHKMKFTRWQSLNRFVLNKGWNNLVEANNLQKGDTVDLWHFRIDLKLRFAINIIKN