Gene Details:

  • Gene ID: Neem_34478_f_1
  • Gene Family: B3 Family
  • Description: B3 Family protein
  • Species: Azadirachta indica
  • Source: B3 family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_016515513.1  — PREDICTED: auxin response factor 19-like
  • Swissprot:  Q0D9R7  — ARFS_ORYSJ; Auxin response factor 19
  • TrEMBL:  A0A1S4DQ13  — A0A1S4DQ13_TOBAC; Auxin response factor
  • STRING:  XP_009594540.1  — (Nicotiana tomentosiformis)

Gene Ontology:

  • GO:0003677  — Molecular Function — DNA binding

Family Introduction:

  • The plant-specific B3 superfamily encompasses well-characterized families, such as the auxin response factor (ARF) family and the LAV family, as well as less well understood families, such as RAV and REM.
  • All members of the B3 superfamily contain an ~ 110 amino acid region called the B3 domain. This domain was initially named because it was the third basic domain in the maize gene VIVIPAROUS1 (VP1).
  • The first and second basic domains (B1 and B2) are specific to the VP1-like proteins, but genes that contain the B3 domain are widespread in plant genomes. The B3 domain of VP1 encodes a sequence-specific DNA binding activity.

Literature:

Sequences:

CDS Sequence:
  • >Neem_34478_f_1|Azadirachta_indica|B3|Neem_34478_f_1
Protein Sequence:
  • >Neem_34478_f_1|Azadirachta_indica|B3|Neem_34478_f_1
    MKTPANSAGASAVMAASNPGEGGEKKTINSELWHACAGPLVNLPAAGTHVVYFPQGHSEQVAASLKKDIDGQVPNYPNLPSKLFCLLLNVTLHADPETDEVYAQMTLQPVTSFEKEDLLRSDLALKSNKPQTEFFCKTLTASDTSTHGGFSVPRRAAEKIFPPLDFSMQPPAQELMARDLHDNVWTFRHIYRGQPKRHLLTTGWSLFVSGKRLFAGDSVLFIR