Gene Details:

  • Gene ID: MLOC_69727.4
  • Gene Family: B3 Family
  • Description: B3 Family protein
  • Species: Hordeum vulgare
  • Source: B3 family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_020155421.1  — B3 domain-containing protein VP1 isoform X1
  • Swissprot:  P37398  — VIV_ORYSJ; B3 domain-containing protein VP1
  • TrEMBL:  A0A446NZJ8  — A0A446NZJ8_TRITD; Uncharacterized protein
  • TrEMBL:  M7Z5Z0  — M7Z5Z0_TRIUA; B3 domain-containing protein VP1
  • STRING:  TRIUR3_22986-P1  — (Triticum urartu)

Gene Ontology:

  • GO:0009657  — Biological Process — plastid organization
  • GO:0009733  — Biological Process — response to auxin
  • GO:0009737  — Biological Process — response to abscisic acid
  • GO:0009793  — Biological Process — embryo development ending in seed dormancy
  • GO:0031930  — Biological Process — mitochondria-nucleus signaling pathway
  • GO:0045893  — Biological Process — positive regulation of transcription, DNA-templated
  • GO:0005634  — Cellular Component — nucleus
  • GO:0005829  — Cellular Component — cytosol
  • GO:0001076  — Molecular Function — transcription factor activity, RNA polymerase II transcription factor binding
  • GO:0003677  — Molecular Function — DNA binding
  • GO:0003700  — Molecular Function — transcription factor activity, sequence-specific DNA binding

Family Introduction:

  • The plant-specific B3 superfamily encompasses well-characterized families, such as the auxin response factor (ARF) family and the LAV family, as well as less well understood families, such as RAV and REM.
  • All members of the B3 superfamily contain an ~ 110 amino acid region called the B3 domain. This domain was initially named because it was the third basic domain in the maize gene VIVIPAROUS1 (VP1).
  • The first and second basic domains (B1 and B2) are specific to the VP1-like proteins, but genes that contain the B3 domain are widespread in plant genomes. The B3 domain of VP1 encodes a sequence-specific DNA binding activity.

Literature:

Sequences:

CDS Sequence:
  • >MLOC_69727.4|Hordeum_vulgare|B3|MLOC_69727.4
    ATGAATGGATCTTCCTCTCTTTCTATTGATCTTGGTGTTGATTTCCTTCTTGATTTCTCGGATTTTGCAAGTGTATCTATCCATGGATCTTCTTGTCTTTCCGCTGATCGATCGGTTGCGACTAAAAAGTGTCTCTTCTTCCATGGATGGTTTCAGAAGGAAGCGGAGACTCACCTGCCGGAGCTCAAGACGGGGGACGGCATCTCGATCCCCATTGAGGACATCGGCACATCTCAGGTGTGGAGCATGCGGTACCGGTTTTGGCCCAACAACAAGAGCAGAATGTATCTTCTAGAGAACACTGGTGACTTCGTTCGCTCGAATGAGCTGCAGGAGGGTGATTTCATCGTGCTCTACTCCGATGTAAAGTCAGGC
Protein Sequence:
  • >MLOC_69727.4|Hordeum_vulgare|B3|MLOC_69727.4
    MNGSSSLSIDLGVDFLLDFSDFASVSIHGSSCLSADRSVATKKCLFFHGWFQKEAETHLPELKTGDGISIPIEDIGTSQVWSMRYRFWPNNKSRMYLLENTGDFVRSNELQEGDFIVLYSDVKSG