Gene Details:
- Gene ID: MLOC_69727.4
- Gene Family: B3 Family
- Description: B3 Family protein
- Species: Hordeum vulgare
- Source: B3 family gene from PlantTFDB
Protein Features:
- PROSITE profile: PS50863
- SMART: SM01019
- SuperFamily: SSF101936
- Pfam: PF02362
- Gene3D: G3DSA:2.40.330.10
- InterPro: IPR003340 IPR015300
Annotation Proteins:
- Refseq: XP_020155421.1 — B3 domain-containing protein VP1 isoform X1
- Swissprot: P37398 — VIV_ORYSJ; B3 domain-containing protein VP1
- TrEMBL: A0A446NZJ8 — A0A446NZJ8_TRITD; Uncharacterized protein
- TrEMBL: M7Z5Z0 — M7Z5Z0_TRIUA; B3 domain-containing protein VP1
- STRING: TRIUR3_22986-P1 — (Triticum urartu)
Gene Ontology:
- GO:0009657 — Biological Process — plastid organization
- GO:0009733 — Biological Process — response to auxin
- GO:0009737 — Biological Process — response to abscisic acid
- GO:0009793 — Biological Process — embryo development ending in seed dormancy
- GO:0031930 — Biological Process — mitochondria-nucleus signaling pathway
- GO:0045893 — Biological Process — positive regulation of transcription, DNA-templated
- GO:0005634 — Cellular Component — nucleus
- GO:0005829 — Cellular Component — cytosol
- GO:0001076 — Molecular Function — transcription factor activity, RNA polymerase II transcription factor binding
- GO:0003677 — Molecular Function — DNA binding
- GO:0003700 — Molecular Function — transcription factor activity, sequence-specific DNA binding
Family Introduction:
- The plant-specific B3 superfamily encompasses well-characterized families, such as the auxin response factor (ARF) family and the LAV family, as well as less well understood families, such as RAV and REM.
- All members of the B3 superfamily contain an ~ 110 amino acid region called the B3 domain. This domain was initially named because it was the third basic domain in the maize gene VIVIPAROUS1 (VP1).
- The first and second basic domains (B1 and B2) are specific to the VP1-like proteins, but genes that contain the B3 domain are widespread in plant genomes. The B3 domain of VP1 encodes a sequence-specific DNA binding activity.
Literature:
Sequences:
CDS Sequence:
- >MLOC_69727.4|Hordeum_vulgare|B3|MLOC_69727.4
ATGAATGGATCTTCCTCTCTTTCTATTGATCTTGGTGTTGATTTCCTTCTTGATTTCTCGGATTTTGCAAGTGTATCTATCCATGGATCTTCTTGTCTTTCCGCTGATCGATCGGTTGCGACTAAAAAGTGTCTCTTCTTCCATGGATGGTTTCAGAAGGAAGCGGAGACTCACCTGCCGGAGCTCAAGACGGGGGACGGCATCTCGATCCCCATTGAGGACATCGGCACATCTCAGGTGTGGAGCATGCGGTACCGGTTTTGGCCCAACAACAAGAGCAGAATGTATCTTCTAGAGAACACTGGTGACTTCGTTCGCTCGAATGAGCTGCAGGAGGGTGATTTCATCGTGCTCTACTCCGATGTAAAGTCAGGC
Protein Sequence:
- >MLOC_69727.4|Hordeum_vulgare|B3|MLOC_69727.4
MNGSSSLSIDLGVDFLLDFSDFASVSIHGSSCLSADRSVATKKCLFFHGWFQKEAETHLPELKTGDGISIPIEDIGTSQVWSMRYRFWPNNKSRMYLLENTGDFVRSNELQEGDFIVLYSDVKSG