Gene Details:

  • Gene ID: Medtr5g062970.1
  • Gene Name: MTR_5g062970
  • Gene Family: B3 Family
  • Description: B3 Family protein
  • Species: Medicago truncatula
  • Source: B3 family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_024640663.1  — auxin response factor 17
  • Swissprot:  Q84WU6  — ARFQ_ARATH; Auxin response factor 17
  • TrEMBL:  G7KAA1  — G7KAA1_MEDTR; Auxin response factor, putative
  • STRING:  AES98003  — (Medicago truncatula)

Gene Ontology:

  • GO:0006355  — Biological Process — regulation of transcription, DNA-templated
  • GO:0005634  — Cellular Component — nucleus
  • GO:0003677  — Molecular Function — DNA binding

Family Introduction:

  • The plant-specific B3 superfamily encompasses well-characterized families, such as the auxin response factor (ARF) family and the LAV family, as well as less well understood families, such as RAV and REM.
  • All members of the B3 superfamily contain an ~ 110 amino acid region called the B3 domain. This domain was initially named because it was the third basic domain in the maize gene VIVIPAROUS1 (VP1).
  • The first and second basic domains (B1 and B2) are specific to the VP1-like proteins, but genes that contain the B3 domain are widespread in plant genomes. The B3 domain of VP1 encodes a sequence-specific DNA binding activity.

Literature:

Sequences:

CDS Sequence:
  • >Medtr5g062970.1|Medicago_truncatula|B3|Medtr5g062970.1
    ATGATGCTAATCACCATCTCAAATCGTGCTCAGAGTTCTGCCCTGTTAAGTGATACCGGGGAGCTACATTCCGAAGCATTCCCCACAAAATCTATATTTACCATCCCCACCAAAATCTGGCAGAAATGTGTCGGAGCCTCAGTCAAGATTCCGAAGCTACATTCTAAAGTTTACTACTTCCCACAAGGTCACTTAAAACATGTCTCCCCTCACACAATCATCACCCTTCTTCATTGTTATCCTCCTTCCATTTCCTGCATCATCTCAGCCGTTGATCTCCTTGTTGATCCTCACACAGATGAAGTCTTTGCCAAACTGCTCCTCACTCCCGTAATGGATGGCCATGGCCACGAACAAGAAGCTCCTCCGGAGGTTCCTGCCGAAGACGACGATGGTTACAATGTTGTTTCCTTTGTCAAGATTCTCACACAATCTGATTGCAATAGTGGCTGTGGATTCATTGTACCTCTCCCTTGCGTTGACTTGATCTTGCCGAAGCTTAGCTTGGACGATCCAATGCCATCTCAGAAACTCTCCGTCACTGACATTCAAGGCCGAATCTGGCAGTACACACATATCTACCGCGGTAAATCCAAGAGACACCTTTTCAGTAGGGGATGGACTTCCTTTGTCAACAACAAGAAACTCGTCGCTGGTGATTCATTTGTTTTTATTAAAAACTCAGCATGGTGGTTGATGTTAAATTGGCATCATCACTAA
Protein Sequence:
  • >Medtr5g062970.1|Medicago_truncatula|B3|Medtr5g062970.1
    MMLITISNRAQSSALLSDTGELHSEAFPTKSIFTIPTKIWQKCVGASVKIPKLHSKVYYFPQGHLKHVSPHTIITLLHCYPPSISCIISAVDLLVDPHTDEVFAKLLLTPVMDGHGHEQEAPPEVPAEDDDGYNVVSFVKILTQSDCNSGCGFIVPLPCVDLILPKLSLDDPMPSQKLSVTDIQGRIWQYTHIYRGKSKRHLFSRGWTSFVNNKKLVAGDSFVFIKNSAWWLMLNWHHH*