Gene Details:

  • Gene ID: GSBRNA2T00127297001
  • Gene Name: GSBRNA2T00127297001
  • Gene Family: B3 Family
  • Description: B3 Family protein
  • Species: Brassica napus
  • Source: B3 family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_013603506.1  — PREDICTED: LOW QUALITY PROTEIN: B3 domain-containing protein REM12
  • Swissprot:  Q8S8E8  — REML1_ARATH; B3 domain-containing protein REM-like 1
  • TrEMBL:  A0A0D3DVL1  — A0A0D3DVL1_BRAOL; Uncharacterized protein
  • STRING:  Bo8g099620.1  — (Brassica oleracea)

Gene Ontology:

  • GO:0006355  — Biological Process — regulation of transcription, DNA-templated
  • GO:0005634  — Cellular Component — nucleus
  • GO:0003677  — Molecular Function — DNA binding

Family Introduction:

  • The plant-specific B3 superfamily encompasses well-characterized families, such as the auxin response factor (ARF) family and the LAV family, as well as less well understood families, such as RAV and REM.
  • All members of the B3 superfamily contain an ~ 110 amino acid region called the B3 domain. This domain was initially named because it was the third basic domain in the maize gene VIVIPAROUS1 (VP1).
  • The first and second basic domains (B1 and B2) are specific to the VP1-like proteins, but genes that contain the B3 domain are widespread in plant genomes. The B3 domain of VP1 encodes a sequence-specific DNA binding activity.

Literature:

Sequences:

CDS Sequence:
  • >GSBRNA2T00127297001|Brassica_napus|B3|GSBRNA2T00127297001
    ATGACCTTAACAATTGAGCATGCGAGCTTCAGAAAAGGCAGCCTGCGTCTTCCACTGCGTTTTATGAAGAAACATGGTTTGGATAAACCTCGGTTGATAACTCTGTTGGGCAAAGATGGTACAAAGTGGGTGGCGAATCTGCGACGTGAAAGCTCAGGTGGAAGAATGAGGTTGGGGAAAGGCTGGAAAGATTTTGCTTTAGACAACGGCTTAAAGGTTGGGGACTCCTTTACGTTTGAGTTAGTCGGGAAAAACAATACTCCTCCTATGATTTAA
Protein Sequence:
  • >GSBRNA2T00127297001|Brassica_napus|B3|GSBRNA2T00127297001
    MTLTIEHASFRKGSLRLPLRFMKKHGLDKPRLITLLGKDGTKWVANLRRESSGGRMRLGKGWKDFALDNGLKVGDSFTFELVGKNNTPPMI*