Gene Details:

  • Gene ID: Gorai.001G273500.3
  • Gene Name: B456_001G273500
  • Gene Family: B3 Family
  • Description: B3 Family protein
  • Species: Gossypium raimondii
  • Source: B3 family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_016723938.1  — PREDICTED: B3 domain-containing transcription factor FUS3-like
  • Swissprot:  Q9LW31  — FUS3_ARATH; B3 domain-containing transcription factor FUS3
  • TrEMBL:  A0A0D2PXK4  — A0A0D2PXK4_GOSRA; Uncharacterized protein
  • STRING:  Gorai.001G273500.1  — (Gossypium raimondii)

Gene Ontology:

  • GO:0006355  — Biological Process — regulation of transcription, DNA-templated
  • GO:0008284  — Biological Process — positive regulation of cell proliferation
  • GO:0009733  — Biological Process — response to auxin
  • GO:0010116  — Biological Process — positive regulation of abscisic acid biosynthetic process
  • GO:0010262  — Biological Process — somatic embryogenesis
  • GO:0010373  — Biological Process — negative regulation of gibberellin biosynthetic process
  • GO:0048573  — Biological Process — photoperiodism, flowering
  • GO:0005634  — Cellular Component — nucleus
  • GO:0003700  — Molecular Function — transcription factor activity, sequence-specific DNA binding
  • GO:0044212  — Molecular Function — transcription regulatory region DNA binding

Family Introduction:

  • The plant-specific B3 superfamily encompasses well-characterized families, such as the auxin response factor (ARF) family and the LAV family, as well as less well understood families, such as RAV and REM.
  • All members of the B3 superfamily contain an ~ 110 amino acid region called the B3 domain. This domain was initially named because it was the third basic domain in the maize gene VIVIPAROUS1 (VP1).
  • The first and second basic domains (B1 and B2) are specific to the VP1-like proteins, but genes that contain the B3 domain are widespread in plant genomes. The B3 domain of VP1 encodes a sequence-specific DNA binding activity.

Literature:

Sequences:

CDS Sequence:
  • >Gorai.001G273500.3|Gossypium_raimondii|B3|Gorai.001G273500.3
    ATGAGTAAAGATCCATTGGAAGTGTGCCCGGGGGAATTCATTTCTAGACTCTATTTTCCTCGTTTTCCGACACAGGTTATTGATCCAAAGAGATTGAGATTCCTTTTCCAGAAGGAACTCAAGAACAGCGACGTAAGCTCCCTCCGAAGAATGATACTCCCTAAGAGAGCAGCGGAGGCTCACTTACCGGTCCTCGAGTCCAAAGAAGGGATCCTCATCAGCATGGACGACTTAGATGGACTGCATGTATGGAGCTTCAAGTACAGGTTTTGGCCGAATAACAACAGCCGTATGTACGTGCTCGAAAATACCGGGGAATTCGTTAGCACGCACGGATTACAGCTCGGGGATTTCATCATGGTGTATCAAGATAGCCTAAACCAGAATTATGTAATCCAGGCGAAGAAGGCATCGGACGAAGATGTATATAGTGACATAGCTAGGAACGGAGTGAATGACCTATTTCTCCATGATTATGAGGCAACTAAGTCCAGCAACTATTACTATCCAATGATGGAGGATAATGGGATGTCATTTATATATGACACCACCTTGAGCTTCTCAAATGACTGCCCACTTGATTTTCTGGGTGGATCAATGACCAACTATTCAAGGATGGGGTCTCTGGAAAGCTTTGGGTCTGTTGAAAACTTGTCACTTGATGAGTTTTATCAACTTTAA
Protein Sequence:
  • >Gorai.001G273500.3|Gossypium_raimondii|B3|Gorai.001G273500.3
    MSKDPLEVCPGEFISRLYFPRFPTQVIDPKRLRFLFQKELKNSDVSSLRRMILPKRAAEAHLPVLESKEGILISMDDLDGLHVWSFKYRFWPNNNSRMYVLENTGEFVSTHGLQLGDFIMVYQDSLNQNYVIQAKKASDEDVYSDIARNGVNDLFLHDYEATKSSNYYYPMMEDNGMSFIYDTTLSFSNDCPLDFLGGSMTNYSRMGSLESFGSVENLSLDEFYQL*