EcC054811.230

Gene Details:

Refseq: XP_010050479.1 — PREDICTED: putative B3 domain-containing protein At4g03160
TrEMBL: A0A059CMH9 — A0A059CMH9_EUCGR; Uncharacterized protein
STRING: XP_010050479.1 — (Eucalyptus grandis)

GO:0006108 — Biological Process — malate metabolic process
GO:0006355 — Biological Process — regulation of transcription, DNA-templated
GO:0006396 — Biological Process — RNA processing
GO:0006486 — Biological Process — protein glycosylation
GO:0015074 — Biological Process — DNA integration
GO:0055085 — Biological Process — transmembrane transport
GO:0055114 — Biological Process — oxidation-reduction process
GO:0016021 — Cellular Component — integral component of membrane
GO:0003677 — Molecular Function — DNA binding
GO:0003700 — Molecular Function — transcription factor activity, sequence-specific DNA binding
GO:0003723 — Molecular Function — RNA binding
GO:0004471 — Molecular Function — malate dehydrogenase (decarboxylating) (NAD+) activity
GO:0004576 — Molecular Function — oligosaccharyl transferase activity
GO:0004616 — Molecular Function — phosphogluconate dehydrogenase (decarboxylating) activity
GO:0005506 — Molecular Function — iron ion binding
GO:0005515 — Molecular Function — protein binding
GO:0005524 — Molecular Function — ATP binding
GO:0008173 — Molecular Function — RNA methyltransferase activity
GO:0008270 — Molecular Function — zinc ion binding
GO:0042626 — Molecular Function — ATPase activity, coupled to transmembrane movement of substances
GO:0051287 — Molecular Function — NAD binding

The plant-specific B3 superfamily encompasses well-characterized families, such as the auxin response factor (ARF) family and the LAV family, as well as less well understood families, such as RAV and REM.
All members of the B3 superfamily contain an ~ 110 amino acid region called the B3 domain. This domain was initially named because it was the third basic domain in the maize gene VIVIPAROUS1 (VP1).
The first and second basic domains (B1 and B2) are specific to the VP1-like proteins, but genes that contain the B3 domain are widespread in plant genomes. The B3 domain of VP1 encodes a sequence-specific DNA binding activity.

CDS Sequence:

>EcC054811.230|Eucalyptus_camaldulensis|B3|EcC054811.230
ATGGAGTTGAAAAATGAGCAAGGAGTCCGACCAATGCAACAACATAGGCAATCGAAAACCATTCAAGCTAGTTCATGTCCAAGTCGGCCACAGCATGATCCACAACACTCAGCGACCGGACTCCACTTGGTTCGGATCGTGGACACGCTTATTGACTCGATCGGAGATTGCAGCGAGCCATTCGAGAAGCAATTGACGACAAGCGACATCATCGGCATTCAGAGCCGGCTGCTCGTGAATAAAACGGACTTTGCAACATCTATCTTGCCCTTGCTCGAGAAGGATGACGACATTGAGGTGGGAATTCCGGTGAAGGCGTTTAATCCAGCGGGGAAGGCGTATCCTATGACGTTCAAAATTTGGTGCGGCAGGTCGCATGTAATCACTAGCGGGTGGAATTTATTCGTTAAGGATAACCGATTGGAGGTTTCGGATATCGTTAGGGTATGGGCTTTTCGCGACGTCTGGACCCGAGAGTTATGCCTCTTGATTTCTAGTAGAAAGCCGGAGGTGCAGCAGCCGATTGAAAAGGAGGAGACG

Protein Sequence:

>EcC054811.230|Eucalyptus_camaldulensis|B3|EcC054811.230
MELKNEQGVRPMQQHRQSKTIQASSCPSRPQHDPQHSATGLHLVRIVDTLIDSIGDCSEPFEKQLTTSDIIGIQSRLLVNKTDFATSILPLLEKDDDIEVGIPVKAFNPAGKAYPMTFKIWCGRSHVITSGWNLFVKDNRLEVSDIVRVWAFRDVWTRELCLLISSRKPEVQQPIEKEET