Gene Details:

  • Gene ID: cra_locus_9764_iso_1
  • Gene Family: B3 Family
  • Description: B3 Family protein
  • Species: Catharanthus roseus
  • Source: B3 family gene from PlantTFDB

Protein Features:

Gene Ontology:

  • GO:0003677  — Molecular Function — DNA binding

Family Introduction:

  • The plant-specific B3 superfamily encompasses well-characterized families, such as the auxin response factor (ARF) family and the LAV family, as well as less well understood families, such as RAV and REM.
  • All members of the B3 superfamily contain an ~ 110 amino acid region called the B3 domain. This domain was initially named because it was the third basic domain in the maize gene VIVIPAROUS1 (VP1).
  • The first and second basic domains (B1 and B2) are specific to the VP1-like proteins, but genes that contain the B3 domain are widespread in plant genomes. The B3 domain of VP1 encodes a sequence-specific DNA binding activity.

Literature:

Sequences:

CDS Sequence:
  • >cra_locus_9764_iso_1|Catharanthus_roseus|B3|cra_locus_9764_iso_1
Protein Sequence:
  • >cra_locus_9764_iso_1|Catharanthus_roseus|B3|cra_locus_9764_iso_1
    MGCTQCECSPDSLNVINVRKSVEDCPVVARTKEVQANLDAQFPSFIKLMLRSHVTKGFWLGLPAKFCKMHLPSNDEKKVTLEDESGAEYETNFLGYKGGLGGGWAGFAMAHNLLEGDAAGLPLVRPCKFKVYIVRSASSGKVDGAVGLLTLENHTSGRAFEIISPQSSSQELNARLAAGIILKTVQIAEKIKACEISTPLEDFAVWDKTLEGFELLGMEVGFLRAQLNKLILFAIESEESPSAKRYMEAKLVELQQVRTRLETEIQTLNMKKQNNQLRFREKANAPWXXGKAWLHEMIX