Gene Details:
- Gene ID: cra_locus_7048_iso_3
- Gene Family: B3 Family
- Description: B3 Family protein
- Species: Catharanthus roseus
- Source: B3 family gene from PlantTFDB
Protein Features:
- PROSITE profile: PS50863
- SMART: SM01019
- SuperFamily: SSF101936
- Pfam: PF02362
- Gene3D: G3DSA:2.40.330.10
- InterPro: IPR003340 IPR015300
Annotation Proteins:
- Refseq: XP_027082046.1 — B3 domain-containing protein Os03g0120900-like
- Refseq: XP_027082047.1 — B3 domain-containing protein Os03g0120900-like
- Refseq: XP_027082049.1 — B3 domain-containing protein Os03g0120900-like
- Refseq: XP_027082050.1 — B3 domain-containing protein Os03g0120900-like
- Refseq: XP_027082051.1 — B3 domain-containing protein Os03g0120900-like
- Refseq: XP_027082052.1 — B3 domain-containing protein Os03g0120900-like
- Refseq: XP_027183229.1 — B3 domain-containing protein Os03g0120900-like
- Refseq: XP_027183230.1 — B3 domain-containing protein Os03g0120900-like
- Swissprot: O82799 — NGA1_ARATH; B3 domain-containing transcription factor NGA1
- TrEMBL: A0A068UVI6 — A0A068UVI6_COFCA; Uncharacterized protein
- STRING: XP_009758550.1 — (Nicotiana sylvestris)
Gene Ontology:
- GO:0009908 — Biological Process — flower development
- GO:0048366 — Biological Process — leaf development
- GO:0003677 — Molecular Function — DNA binding
Family Introduction:
- The plant-specific B3 superfamily encompasses well-characterized families, such as the auxin response factor (ARF) family and the LAV family, as well as less well understood families, such as RAV and REM.
- All members of the B3 superfamily contain an ~ 110 amino acid region called the B3 domain. This domain was initially named because it was the third basic domain in the maize gene VIVIPAROUS1 (VP1).
- The first and second basic domains (B1 and B2) are specific to the VP1-like proteins, but genes that contain the B3 domain are widespread in plant genomes. The B3 domain of VP1 encodes a sequence-specific DNA binding activity.
Literature:
Sequences:
CDS Sequence:
- >cra_locus_7048_iso_3|Catharanthus_roseus|B3|cra_locus_7048_iso_3
Protein Sequence:
- >cra_locus_7048_iso_3|Catharanthus_roseus|B3|cra_locus_7048_iso_3
MNFMPNRAGFCEDDPRSVRPFSQSSSTSSSSSSLQQQQQQQKGVVVPLSYNQHHQQYHLQQQQSRWGWDETIAFRYSSGEGVSQLDLMRDSSSPAHVNNVDDTADDSEEHLLMRPQGGGGDHSIEGTAASVSMTIEREHMFDKVVTPSDVGKLNRLVIPKQHAEKYFPLDSSTNEKGLLLNFEDRNGKPWRFRYSYWNSSQSYVMTKGWSRFVKEKKLDAGDIVSFQRGVGELGKDRLFIDWRRRPDAPLDHHRHHHLPPPPIPSLSLPHHFSFHPWNHPYYLQQQQQQPRDSSHQAFLQSHLKSYGTNYYSSSSGVMNGNPCPGSVLYLRSAPTSAAASPQQVGVGMVQLQRGSNRNNVGVEEAMVFESVPVVQGKAAAKRLRLFGVNMECPIPESDDQCDNILSSTAVPHSMMPQQASHTHFSSSSSISPLQLRPYSGTPVLQTLPSDLQNKGKSSMSLDFDV