Gene Details:
- Gene ID: cra_locus_4692_iso_2
- Gene Family: B3 Family
- Description: B3 Family protein
- Species: Catharanthus roseus
- Source: B3 family gene from PlantTFDB
Protein Features:
- PROSITE profile: PS50863
- SMART: SM01019
- SuperFamily: SSF101936
- Pfam: PF02362
- Gene3D: G3DSA:2.40.330.10
- InterPro: IPR003340 IPR015300
Annotation Proteins:
- Refseq: XP_016515513.1 — PREDICTED: auxin response factor 19-like
- Refseq: XP_016580257.1 — PREDICTED: auxin response factor 19-like
- Swissprot: Q0D9R7 — ARFS_ORYSJ; Auxin response factor 19
- TrEMBL: A0A1S4DQ13 — A0A1S4DQ13_TOBAC; Auxin response factor
- TrEMBL: A0A2G2WBM6 — A0A2G2WBM6_CAPBA; Auxin response factor
- STRING: XP_009594540.1 — (Nicotiana tomentosiformis)
Gene Ontology:
- GO:0006355 — Biological Process — regulation of transcription, DNA-templated
- GO:0009723 — Biological Process — response to ethylene
- GO:0009733 — Biological Process — response to auxin
- GO:0010311 — Biological Process — lateral root formation
- GO:0048366 — Biological Process — leaf development
- GO:0005634 — Cellular Component — nucleus
- GO:0043565 — Molecular Function — sequence-specific DNA binding
- GO:0046983 — Molecular Function — protein dimerization activity
Family Introduction:
- The plant-specific B3 superfamily encompasses well-characterized families, such as the auxin response factor (ARF) family and the LAV family, as well as less well understood families, such as RAV and REM.
- All members of the B3 superfamily contain an ~ 110 amino acid region called the B3 domain. This domain was initially named because it was the third basic domain in the maize gene VIVIPAROUS1 (VP1).
- The first and second basic domains (B1 and B2) are specific to the VP1-like proteins, but genes that contain the B3 domain are widespread in plant genomes. The B3 domain of VP1 encodes a sequence-specific DNA binding activity.
Literature:
Sequences:
CDS Sequence:
- >cra_locus_4692_iso_2|Catharanthus_roseus|B3|cra_locus_4692_iso_2
Protein Sequence:
- >cra_locus_4692_iso_2|Catharanthus_roseus|B3|cra_locus_4692_iso_2
MKTSANGAGAPLATASGNPTEGEKKSINPELWQACAGPLVNLPAAGTHVVYFPQGHSEQVAASMKKDVDAQIPNYPNLPSKLLCLLHNVTLHADPETDEVYAQMTLQPVPSFDKDALLRSDLTMKANKPQTEFFCKTLTASDTSTHGGFSVPRRAAEKIFPPLDFTMQPPAQELVARDLHDNVWTFRHIYRGQPKRHLLTTGWSLFVSGKRLFAGDSVLFIRDEKQQLLLGIRRANRQPTNLSSSVLSSDSMHIGILAAAAHAAANNSPFTVFYNPR