Gene Details:

  • Gene ID: cra_locus_4547_iso_7
  • Gene Family: B3 Family
  • Description: B3 Family protein
  • Species: Catharanthus roseus
  • Source: B3 family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_027171592.1  — auxin response factor 6-like
  • Swissprot:  Q9ZTX8  — ARFF_ARATH; Auxin response factor 6
  • TrEMBL:  A0A059DGD2  — A0A059DGD2_EUCGR; Auxin response factor (Fragment)
  • TrEMBL:  A0A059DH82  — A0A059DH82_EUCGR; Auxin response factor (Fragment)
  • TrEMBL:  A0A068UB17  — A0A068UB17_COFCA; Auxin response factor
  • TrEMBL:  A0A166IKM0  — A0A166IKM0_DAUCS; Auxin response factor
  • STRING:  evm.model.supercontig_17.53  — (Carica papaya)
  • STRING:  XP_002532983.1  — (Ricinus communis)

Gene Ontology:

  • GO:0006355  — Biological Process — regulation of transcription, DNA-templated
  • GO:0009725  — Biological Process — response to hormone
  • GO:0005634  — Cellular Component — nucleus
  • GO:0003677  — Molecular Function — DNA binding
  • GO:0005515  — Molecular Function — protein binding

Family Introduction:

  • The plant-specific B3 superfamily encompasses well-characterized families, such as the auxin response factor (ARF) family and the LAV family, as well as less well understood families, such as RAV and REM.
  • All members of the B3 superfamily contain an ~ 110 amino acid region called the B3 domain. This domain was initially named because it was the third basic domain in the maize gene VIVIPAROUS1 (VP1).
  • The first and second basic domains (B1 and B2) are specific to the VP1-like proteins, but genes that contain the B3 domain are widespread in plant genomes. The B3 domain of VP1 encodes a sequence-specific DNA binding activity.

Literature:

Sequences:

CDS Sequence:
  • >cra_locus_4547_iso_7|Catharanthus_roseus|B3|cra_locus_4547_iso_7
Protein Sequence:
  • >cra_locus_4547_iso_7|Catharanthus_roseus|B3|cra_locus_4547_iso_7
    MRLSSPGFSLQSPEGEKRCLNSELWHACAGPLVSLPAVGSRVVYFPQGHSEQVAASTNKEVDHIPNVSSLPPQLICQLHNVTMHADVETDEVYAQMTLQPMSPQEQKEASFLPADLGSPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPAQELIARDLHDNEWKFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIW