Gene Details:

  • Gene ID: BGIOSGA013137-PA
  • Gene Name: OsI_12639
  • Gene Family: B3 Family
  • Description: B3 Family protein
  • Species: Oryza sativa subsp. indica
  • Source: B3 family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_015630232.2  — LOW QUALITY PROTEIN: B3 domain-containing protein Os03g0620500-like
  • Swissprot:  Q851W4  — Y3205_ORYSJ; B3 domain-containing protein Os03g0620500
  • TrEMBL:  B8AMK6  — B8AMK6_ORYSI; Uncharacterized protein
  • TrEMBL:  C7J026  — C7J026_ORYSJ; Os03g0620500 protein
  • TrEMBL:  I1PDJ5  — I1PDJ5_ORYGL; Uncharacterized protein
  • STRING:  OS03T0620500-01  — (Oryza sativa)
  • STRING:  ORGLA03G0244100.1  — (Oryza glaberrima)
  • STRING:  OBART03G26260.1  — (Oryza barthii)

Gene Ontology:

  • GO:0006355  — Biological Process — regulation of transcription, DNA-templated
  • GO:0005634  — Cellular Component — nucleus
  • GO:0003677  — Molecular Function — DNA binding

Family Introduction:

  • The plant-specific B3 superfamily encompasses well-characterized families, such as the auxin response factor (ARF) family and the LAV family, as well as less well understood families, such as RAV and REM.
  • All members of the B3 superfamily contain an ~ 110 amino acid region called the B3 domain. This domain was initially named because it was the third basic domain in the maize gene VIVIPAROUS1 (VP1).
  • The first and second basic domains (B1 and B2) are specific to the VP1-like proteins, but genes that contain the B3 domain are widespread in plant genomes. The B3 domain of VP1 encodes a sequence-specific DNA binding activity.

Literature:

Sequences:

CDS Sequence:
  • >BGIOSGA013137-PA|Oryza_sativa_subsp._indica|B3|BGIOSGA013137-PA
    ATGGCTGGACAAGGTTCCCAGATGAAGAAATACTGTGATTGCTGCAAAAGATATGTGGACCATTCCAATGGAAAGATGAAATGCTTCCACAGGCAAATGAGTGCTAATTTTGAGCATAGCATGATCATACCAAACAAGTTCTTGGACCAATTCGGAGGGAAAATATCAAGAACAGTTGAACTAGAATCCCCCAAGGGCAATGTGTATGTCGTCAAAGTTAGCAAGCACATGAATAAGACAGTCCTCCAGTGTGGATGGGAGGCATTTGTAGATGCCCATCAGATAGAAGAGAATGACTCCTTATTGTTCCGTCACATCAAGAATTCCCGGTTCTGA
Protein Sequence:
  • >BGIOSGA013137-PA|Oryza_sativa_subsp._indica|B3|BGIOSGA013137-PA
    MAGQGSQMKKYCDCCKRYVDHSNGKMKCFHRQMSANFEHSMIIPNKFLDQFGGKISRTVELESPKGNVYVVKVSKHMNKTVLQCGWEAFVDAHQIEENDSLLFRHIKNSRF