Gene Details:

  • Gene ID: AT3G11580.2
  • Gene Family: B3 Family
  • Description: B3 Family protein
  • Species: Arabidopsis thaliana
  • Source: B3 family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  NP_001319524.1  — AP2/B3-like transcriptional factor family protein
  • Refseq:  NP_001327713.1  — AP2/B3-like transcriptional factor family protein
  • Refseq:  NP_850559.1  — AP2/B3-like transcriptional factor family protein
  • Swissprot:  Q8RYD3  — Y3158_ARATH; B3 domain-containing protein At3g11580
  • TrEMBL:  A0A178VH52  — A0A178VH52_ARATH; Uncharacterized protein
  • STRING:  AT3G11580.1  — (Arabidopsis thaliana)

Gene Ontology:

  • GO:0006355  — Biological Process — regulation of transcription, DNA-templated
  • GO:0080113  — Biological Process — regulation of seed growth
  • GO:0005634  — Cellular Component — nucleus
  • GO:0003700  — Molecular Function — transcription factor activity, sequence-specific DNA binding
  • GO:0043565  — Molecular Function — sequence-specific DNA binding
  • GO:0044212  — Molecular Function — transcription regulatory region DNA binding

Family Introduction:

  • The plant-specific B3 superfamily encompasses well-characterized families, such as the auxin response factor (ARF) family and the LAV family, as well as less well understood families, such as RAV and REM.
  • All members of the B3 superfamily contain an ~ 110 amino acid region called the B3 domain. This domain was initially named because it was the third basic domain in the maize gene VIVIPAROUS1 (VP1).
  • The first and second basic domains (B1 and B2) are specific to the VP1-like proteins, but genes that contain the B3 domain are widespread in plant genomes. The B3 domain of VP1 encodes a sequence-specific DNA binding activity.

Literature:

Sequences:

CDS Sequence:
  • >AT3G11580.2|Arabidopsis_thaliana|B3|AT3G11580.2
    ATGTCAGTCAACCATTACCACAACACTCTCTCGTTGCATCATCACCACCAAAACGACGTAGCTATAGCACAACGAGAGTCTTTGTTCGAGAAATCACTCACACCAAGCGACGTCGGAAAGCTAAACCGCTTAGTCATACCAAAACAACACGCCGAGAAATACTTCCCTCTCAATAATAATAATAATAATGGCGGCAGCGGAGATGACGTGGCGACGACGGAGAAAGGGATGCTTCTTAGCTTCGAGGATGAGTCAGGCAAGTGTTGGAAATTCAGATACTCTTATTGGAACAGTAGCCAAAGCTACGTGTTGACCAAAGGATGGAGCAGGTACGTCAAAGACAAACACCTCGACGCAGGCGACGTTGTTTTCTTTCAACGTCACCGTTTTGATCTCCATAGACTCTTCATTGGCTGGCGGAGACGCGGTGAAGCTTCTTCCTCTCCCGCTGTCTCCGTTGTGTCTCAAGAAGCTCTAGTTAATACGACGGCGTATTGGAGCGGCTTGACTACACCTTATCGTCAAGTACACGCGTCAACTACTTACCCTAATATTCACCAAGAGTATTCACACTATGGTAAATTCAAACCCTTTATTTCCTCTTTTGTTTTTTCTTTCTCTCTTATCTATATGTCAGATTTATACTCCTCTCTGTTCTCTTTTAAGATTTGTCTTTTTCATAAAAATAGATGA
Protein Sequence:
  • >AT3G11580.2|Arabidopsis_thaliana|B3|AT3G11580.2
    MSVNHYHNTLSLHHHHQNDVAIAQRESLFEKSLTPSDVGKLNRLVIPKQHAEKYFPLNNNNNNGGSGDDVATTEKGMLLSFEDESGKCWKFRYSYWNSSQSYVLTKGWSRYVKDKHLDAGDVVFFQRHRFDLHRLFIGWRRRGEASSSPAVSVVSQEALVNTTAYWSGLTTPYRQVHASTTYPNIHQEYSHYGKFKPFISSFVFSFSLIYMSDLYSSLFSFKICLFHKNR