Gene Details:

  • Gene ID: Aradu.NL5W9
  • Gene Family: B3 Family
  • Description: B3 Family protein
  • Species: Arachis duranensis
  • Source: B3 family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_015943443.1  — B3 domain-containing protein Os07g0563300 isoform X2
  • Refseq:  XP_016180730.1  — B3 domain-containing protein Os07g0563300 isoform X2
  • Refseq:  XP_020970625.1  — B3 domain-containing protein Os07g0563300 isoform X2
  • Refseq:  XP_020989871.1  — B3 domain-containing protein Os07g0563300 isoform X2
  • Refseq:  XP_025622085.1  — B3 domain-containing protein Os07g0563300 isoform X2
  • Refseq:  XP_025681660.1  — B3 domain-containing protein Os07g0563300 isoform X2
  • Refseq:  XP_029145383.1  — B3 domain-containing protein Os07g0563300 isoform X2
  • Refseq:  XP_029152134.1  — B3 domain-containing protein Os07g0563300 isoform X2
  • Swissprot:  Q5CCK4  — VAL2_ARATH; B3 domain-containing transcription repressor VAL2
  • TrEMBL:  A0A444WY85  — A0A444WY85_ARAHY; Uncharacterized protein
  • STRING:  GLYMA15G07350.1  — (Glycine max)
  • STRING:  XP_007148240.1  — (Phaseolus vulgaris)
  • STRING:  XP_010040771.1  — (Eucalyptus grandis)

Gene Ontology:

  • GO:0003677  — Molecular Function — DNA binding

Family Introduction:

  • The plant-specific B3 superfamily encompasses well-characterized families, such as the auxin response factor (ARF) family and the LAV family, as well as less well understood families, such as RAV and REM.
  • All members of the B3 superfamily contain an ~ 110 amino acid region called the B3 domain. This domain was initially named because it was the third basic domain in the maize gene VIVIPAROUS1 (VP1).
  • The first and second basic domains (B1 and B2) are specific to the VP1-like proteins, but genes that contain the B3 domain are widespread in plant genomes. The B3 domain of VP1 encodes a sequence-specific DNA binding activity.

Literature:

Sequences:

CDS Sequence:
  • >Aradu.NL5W9|Arachis_duranensis|B3|Aradu.NL5W9
    ATGAAACAGGCCTACTTCCCACCAATTTCACAGCCTGAAGGATTGCCACTTAAAATCCTTGATGCAAAAGGCAAGGAATGGATATTTCAATTTCGCTTCTGGCCAAACAATAATAGCAGGATGTATGTTTTAGAGGGTGTCACTCCTTGCATACAGTCAATGCAGTTGCAAGTAGGTGACACAGTAACATTTAGTCGATTGGAGCCAGAAGGGAGGTTGGTTATGGGATTTAGAAAGGCTTCAAATGCCACGCCATCTGATCAGAGATTTCACTTTTGGAAACAGAAAAAGCCTCTGATATCCAATTGTGGTGCCATTTGTAACTCTCTTCAAAAGATAAAGACCGACAAGTACATTCAAAGGCAACCCAAGGTAATTGACTAA
Protein Sequence:
  • >Aradu.NL5W9|Arachis_duranensis|B3|Aradu.NL5W9
    MKQAYFPPISQPEGLPLKILDAKGKEWIFQFRFWPNNNSRMYVLEGVTPCIQSMQLQVGDTVTFSRLEPEGRLVMGFRKASNATPSDQRFHFWKQKKPLISNCGAICNSLQKIKTDKYIQRQPKVID