Gene Details:

  • Gene ID: AA69G00052
  • Gene Family: B3 Family
  • Description: B3 Family protein
  • Species: Aethionema arabicum
  • Source: B3 family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  NP_192068.1  — AP2/B3-like transcriptional factor family protein
  • Swissprot:  Q9ZSH7  — Y4158_ARATH; B3 domain-containing protein At4g01580
  • TrEMBL:  A0A1J3J149  — A0A1J3J149_NOCCA; B3 domain-containing protein (Fragment)
  • STRING:  AT4G01580.1  — (Arabidopsis thaliana)

Gene Ontology:

  • GO:0003677  — Molecular Function — DNA binding

Family Introduction:

  • The plant-specific B3 superfamily encompasses well-characterized families, such as the auxin response factor (ARF) family and the LAV family, as well as less well understood families, such as RAV and REM.
  • All members of the B3 superfamily contain an ~ 110 amino acid region called the B3 domain. This domain was initially named because it was the third basic domain in the maize gene VIVIPAROUS1 (VP1).
  • The first and second basic domains (B1 and B2) are specific to the VP1-like proteins, but genes that contain the B3 domain are widespread in plant genomes. The B3 domain of VP1 encodes a sequence-specific DNA binding activity.

Literature:

Sequences:

CDS Sequence:
  • >AA69G00052|Aethionema_arabicum|B3|AA69G00052
    AAGATTCCGCCAAGATTCGCGAAGCTTCATGGGTCTAAACTCTCCAAGTTTGTGACTTTTAAGACTCCTATAGGGCTTAACCGTTCAATTCAAATTAAACATATATGTGAAGAGATTTGGTTCCAAGAGGGTTGGATTGAGTTTGCAGAAGCTCATTCCATAGCTGAAGGTCATCTCCTCATGTTTGAATTCAACGGAAAATCAACTTTCCATGTAGTGATCTTTGATGTAACAGCTTTTGAAATCAAATATCCATTTGATGAAGACAAAGATGTTGAAATCATCGAAATCATGGGCGGTTCTGATGATTCAGACCACAAACCTAAGAAGAGAACATCAGACTTCGGCTTTCACCAGATTCTAATTGATATTGATGCCATGGATTCACATGAAGCTCTTAAAGAAGACAAGAGAGACTTCAGGGGAAAACAGAGCTTT
Protein Sequence:
  • >AA69G00052|Aethionema_arabicum|B3|AA69G00052
    KIPPRFAKLHGSKLSKFVTFKTPIGLNRSIQIKHICEEIWFQEGWIEFAEAHSIAEGHLLMFEFNGKSTFHVVIFDVTAFEIKYPFDEDKDVEIIEIMGGSDDSDHKPKKRTSDFGFHQILIDIDAMDSHEALKEDKRDFRGKQSF