Gene Details:
- Gene ID: AA36G00045
- Gene Family: B3 Family
- Description: B3 Family protein
- Species: Aethionema arabicum
- Source: B3 family gene from PlantTFDB
Protein Features:
- PROSITE profile: PS50863
- SMART: SM01019
- SuperFamily: SSF101936
- Pfam: PF02362
- Gene3D: G3DSA:2.40.330.10
- InterPro: IPR003340 IPR015300
Annotation Proteins:
- Refseq: XP_006293000.1 — B3 domain-containing protein REM20
- Refseq: XP_006403705.1 — B3 domain-containing protein REM20
- Swissprot: Q8LAV5 — REM20_ARATH; B3 domain-containing protein REM20
- TrEMBL: R0HPM7 — R0HPM7_9BRAS; Uncharacterized protein
- TrEMBL: V4LZ34 — V4LZ34_EUTSA; Uncharacterized protein
- STRING: Cagra.0612s0056.1.p — (Capsella grandiflora)
Gene Ontology:
- GO:0003677 — Molecular Function — DNA binding
Family Introduction:
- The plant-specific B3 superfamily encompasses well-characterized families, such as the auxin response factor (ARF) family and the LAV family, as well as less well understood families, such as RAV and REM.
- All members of the B3 superfamily contain an ~ 110 amino acid region called the B3 domain. This domain was initially named because it was the third basic domain in the maize gene VIVIPAROUS1 (VP1).
- The first and second basic domains (B1 and B2) are specific to the VP1-like proteins, but genes that contain the B3 domain are widespread in plant genomes. The B3 domain of VP1 encodes a sequence-specific DNA binding activity.
Literature:
Sequences:
CDS Sequence:
- >AA36G00045|Aethionema_arabicum|B3|AA36G00045
ATGGCTGATAATGGCATTCTTCCACGTTTCTTCTTAGTTTTCCTCTCAGAAAGCTGTACTGAAAGCCTTGCGATTCCCCTATCATTCAACCAACATCTTCGAAATCCATTGCCAAGAACCGCTAAGTTCCAAGGCTGTGGGCCAAAAGTTTGGAAAGTAGATATGAGAAAAAGAGAGGAATATATATATTTTACGGTTGGTTGGCAAGAATTTGCCGAAGAAAATGATCTAACAGACGGTGAGTTCTTGACATTTGTGTATGATGGTTCTCGAACCTTTGAAGTTAGCATATACAACCGTTATGGATGTAAAGAAACCAGAGGTCAGGGGAATCAACAAGTAAATTTTTTTTGCATCTTCCAAAGAGTTTCCCAACCTAAAGCC
Protein Sequence:
- >AA36G00045|Aethionema_arabicum|B3|AA36G00045
MADNGILPRFFLVFLSESCTESLAIPLSFNQHLRNPLPRTAKFQGCGPKVWKVDMRKREEYIYFTVGWQEFAEENDLTDGEFLTFVYDGSRTFEVSIYNRYGCKETRGQGNQQVNFFCIFQRVSQPKA