Gene Details:
- Gene ID: 85261
- Gene Name: HSI2L-1, HSI2L-2, SELMODRAFT_451634, SELMODRAFT_451635
- Gene Family: B3 Family
- Description: B3 Family protein
- Species: Selaginella moellendorffii
- Source: B3 family gene from PlantTFDB
Protein Features:
- PROSITE profile: PS50863
- SMART: SM01019
- SuperFamily: SSF101936
- Pfam: PF02362
- Gene3D: G3DSA:2.40.330.10
- InterPro: IPR003340 IPR015300
Annotation Proteins:
- Refseq: XP_002966355.2 — B3 domain-containing transcription repressor VAL2
- Refseq: XP_002978205.2 — B3 domain-containing transcription repressor VAL2
- Swissprot: Q5CCK4 — VAL2_ARATH; B3 domain-containing transcription repressor VAL2
- Swissprot: Q6Z3U3 — Y7797_ORYSJ; B3 domain-containing protein Os07g0679700
- TrEMBL: D8R4W3 — D8R4W3_SELML; Uncharacterized protein HSI2L-1
- STRING: EFJ20862 — (Selaginella moellendorffii)
- STRING: EFJ32382 — (Selaginella moellendorffii)
Gene Ontology:
- GO:0003677 — Molecular Function — DNA binding
Family Introduction:
- The plant-specific B3 superfamily encompasses well-characterized families, such as the auxin response factor (ARF) family and the LAV family, as well as less well understood families, such as RAV and REM.
- All members of the B3 superfamily contain an ~ 110 amino acid region called the B3 domain. This domain was initially named because it was the third basic domain in the maize gene VIVIPAROUS1 (VP1).
- The first and second basic domains (B1 and B2) are specific to the VP1-like proteins, but genes that contain the B3 domain are widespread in plant genomes. The B3 domain of VP1 encodes a sequence-specific DNA binding activity.
Literature:
Sequences:
CDS Sequence:
- >85261|Selaginella_moellendorffii|B3|85261
CTCACGGCAAGTGATGCTGGACGAATCGGCCGCTTGGTGCTCCCAAAAGCTTGTGCTGAGGCTTTTTTTCCTCCTATATCTTCGCCCGAGGGAATACCGATCAAAATGAGCGACTCGAAAGGCCAAGAGTGGCAATTCCAGTTTCGGTTCTGGCCAAACAACAGCAGCAGGATGTACGTTTTGGAAGGCATCACTCCTTGCGTCAAAGCATTGCAACTGCAAGCCGGTGATGTAGGTGAGTGA
Protein Sequence:
- >85261|Selaginella_moellendorffii|B3|85261
LTASDAGRIGRLVLPKACAEAFFPPISSPEGIPIKMSDSKGQEWQFQFRFWPNNSSRMYVLEGITPCVKALQLQAGDVGE*