Gene Details:

  • Gene ID: 462902599
  • Gene Family: B3 Family
  • Description: B3 Family protein
  • Species: Eragrostis tef
  • Source: B3 family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_025827675.1  — B3 domain-containing protein Os11g0197600-like
  • Refseq:  XP_025827676.1  — B3 domain-containing protein Os11g0197600-like
  • Swissprot:  Q2R9D2  — Y1176_ORYSJ; B3 domain-containing protein Os11g0197600
  • TrEMBL:  A0A0A9IA08  — A0A0A9IA08_ARUDO; Uncharacterized protein
  • TrEMBL:  A0A0A9NR78  — A0A0A9NR78_ARUDO; Uncharacterized protein
  • TrEMBL:  A0A2S3ID18  — A0A2S3ID18_9POAL; Uncharacterized protein
  • TrEMBL:  A0A2T7CLC4  — A0A2T7CLC4_9POAL; Uncharacterized protein
  • TrEMBL:  A0A3L6PN77  — A0A3L6PN77_PANMI; B3 domain-containing protein
  • STRING:  Pavir.Ha01581.1.p  — (Panicum virgatum)
  • STRING:  Pavir.J23006.1.p  — (Panicum virgatum)

Gene Ontology:

  • GO:0003677  — Molecular Function — DNA binding

Family Introduction:

  • The plant-specific B3 superfamily encompasses well-characterized families, such as the auxin response factor (ARF) family and the LAV family, as well as less well understood families, such as RAV and REM.
  • All members of the B3 superfamily contain an ~ 110 amino acid region called the B3 domain. This domain was initially named because it was the third basic domain in the maize gene VIVIPAROUS1 (VP1).
  • The first and second basic domains (B1 and B2) are specific to the VP1-like proteins, but genes that contain the B3 domain are widespread in plant genomes. The B3 domain of VP1 encodes a sequence-specific DNA binding activity.

Literature:

Sequences:

CDS Sequence:
  • >462902599|Eragrostis_tef|B3|462902599
    ATGGAGGAAGCAACAGACTCTTGCTTGCTTGCCCAAATTAATATCCCATCTGAATTTGTCAGAGAGTACCTGCCCCAGTCAGGCAAGAAGATGACACTCTGGGATCCTCAAGGAAAACCATGGGAAGTGCAGTATGTGTACAATAACCAGCGCTCTATTGCTGCTTTCAGCGGTGGCTGGGGCGAATTCGCTGTAGGCAACAATTTGGAGAAGTTTGATGTTTGCGTCTTTGAGCTTTTAAACGAGGATAACATAAAAGCTCACATCTACAGGATTGTTCTCCAGATTACTCCGCTTCTCTGCAACAAAAGCATTCAGCCTTTAGCATCAAATTGCATCTCAATTGGAAGGCAAGAGGGAGAAAAATTCATTCATGGACTTAACGGCTAA
Protein Sequence:
  • >462902599|Eragrostis_tef|B3|462902599
    MEEATDSCLLAQINIPSEFVREYLPQSGKKMTLWDPQGKPWEVQYVYNNQRSIAAFSGGWGEFAVGNNLEKFDVCVFELLNEDNIKAHIYRIVLQITPLLCNKSIQPLASNCISIGRQEGEKFIHGLNG