Gene Details:

  • Gene ID: 39429
  • Gene Name: ABI3C-1, SELMODRAFT_451619
  • Gene Family: B3 Family
  • Description: B3 Family protein
  • Species: Selaginella moellendorffii
  • Source: B3 family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_002973460.2  — regulatory protein viviparous-1
  • Refseq:  XP_002993595.1  — regulatory protein viviparous-1
  • Swissprot:  P26307  — VIV1_MAIZE; Regulatory protein viviparous-1
  • TrEMBL:  D8R649  — D8R649_SELML; Uncharacterized protein ABI3C-1
  • TrEMBL:  D8SGB6  — D8SGB6_SELML; Uncharacterized protein ABI3C-2
  • STRING:  EFJ16661  — (Selaginella moellendorffii)
  • STRING:  EFJ32605  — (Selaginella moellendorffii)

Gene Ontology:

  • GO:0003677  — Molecular Function — DNA binding

Family Introduction:

  • The plant-specific B3 superfamily encompasses well-characterized families, such as the auxin response factor (ARF) family and the LAV family, as well as less well understood families, such as RAV and REM.
  • All members of the B3 superfamily contain an ~ 110 amino acid region called the B3 domain. This domain was initially named because it was the third basic domain in the maize gene VIVIPAROUS1 (VP1).
  • The first and second basic domains (B1 and B2) are specific to the VP1-like proteins, but genes that contain the B3 domain are widespread in plant genomes. The B3 domain of VP1 encodes a sequence-specific DNA binding activity.

Literature:

Sequences:

CDS Sequence:
  • >39429|Selaginella_moellendorffii|B3|39429
    CTCAAGCCAAGCGACGTTGGAAACCTGGGAAGGATTGTCCTCCCAAAGAAAGAAGCTGAGAGCTGCCTGCCTTACTTGACTGTCCGAGAAGGGATGACGATTGTGATGGAGGATCTGACCACCGCATATAAGTGGCACATGAGATACAGATTCTGGCCGAACAACAAAAGCCGAATGTATCTTCTGGAGAACACGGGAGAGTTTATCAGGTCCCATTGTCTTAAAGAAGGAGATCTTCTGCGGCTTTAC
Protein Sequence:
  • >39429|Selaginella_moellendorffii|B3|39429
    LKPSDVGNLGRIVLPKKEAESCLPYLTVREGMTIVMEDLTTAYKWHMRYRFWPNNKSRMYLLENTGEFIRSHCLKEGDLLRLY