Gene Details:
- Gene ID: Traes_7AS_503B57D77.1
- Gene Family: ARR-B Family
- Description: ARR-B Family protein
- Species: Triticum aestivum
- Source: ARR-B family gene from PlantTFDB
Protein Features:
- SuperFamily: SSF52172
- Gene3D: G3DSA:3.40.50.2300
- SMART: SM00448
- PROSITE profile: PS50110
- Pfam: PF00072
- SuperFamily: SSF46689
- Gene3D: G3DSA:1.10.10.60
- TIGRFAMs: TIGR01557
- Pfam: PF00249
- InterPro: IPR011006 IPR001789 IPR009057 IPR006447 IPR001005
Annotation Proteins:
- Refseq: XP_020175011.1 — two-component response regulator ORR22-like isoform X3
- Refseq: XP_020175012.1 — two-component response regulator ORR22-like isoform X4
- Refseq: XP_020190045.1 — two-component response regulator ORR22-like
- Swissprot: B8B3I4 — ORR22_ORYSI; Two-component response regulator ORR22
- Swissprot: Q5SML5 — ORR22_ORYSJ; Two-component response regulator ORR22
- TrEMBL: A0A3B6RAC7 — A0A3B6RAC7_WHEAT; Two-component response regulator
- STRING: Traes_7AS_503B57D77.1 — (Triticum aestivum)
Gene Ontology:
- GO:0000160 — Biological Process — phosphorelay signal transduction system
- GO:0006355 — Biological Process — regulation of transcription, DNA-templated
- GO:0005634 — Cellular Component — nucleus
- GO:0003677 — Molecular Function — DNA binding
- GO:0003700 — Molecular Function — transcription factor activity, sequence-specific DNA binding
Family Introduction:
- The Arabidopsis genome codes for 22 response regulators (ARRs), 12 of which contain a Myb-like DNA binding domain called ARRM (type B). The remainder (type A) possess no apparent functional unit other than a signal receiver domain containing two aspartate and one lysine residues (DDK) at invariant positions, and their genes are transcriptionally induced by cytokinins without de novo protein synthesis. The type B members, ARR1 and ARR2, bind DNA in a sequence-specific manner and work as transcriptional activators.
- Here we present evidence that ARR1 mediates a cytokinin signal, probably through its NH2-terminal signal receiver domain, and transactivates ARR6, which is immediately responsive to cytokinins. A paralogous response regulator, ARR2, shows almost identical characteristics to ARR1, suggesting a functional overlap. Residual cytokinin responses observed with the arr1-1 mutant may have been provided by ARR2. In addition to ARR6, other type A member genes, including ARR4, ARR5, ARR7, ARR8, and ARR9, were also activated by DEX at various levels in 35S::ARR1DDK::GR plants, suggesting that all the immediate cytokinin-responsive genes belonging to this group are directly activated by ARR1. Also, other cytokinin-responsive genes whose promoter regions contain the ARR1 recognition sequences are possibly transactivated by ARR1. A screening for ARR1 target genes using transgenic 35S::ARR1-DDK::GR plants will shed light on the whole view of the early cytokinin signal transduction pathway. We conclude that ARR1 is a principal transcription factor-type response regulator that is involved in an early step of cytokinin signal transduction, possibly as a partner of the sensor histidine kinase CRE1.
Literature:
- ARR1, a Transcription Factor for Genes Immediately Responsive to Cytokinins. DOI: 10.1126/science.1065201 ; PMID: 11691951
Sequences:
CDS Sequence:
- >Traes_7AS_503B57D77.1|Triticum_aestivum|ARR-B|Traes_7AS_503B57D77.1
ATGCTTTTGGACGCCATGATGATGGAGGCCAGGAAGGGGTTAATGGAGAGGGACCAGTTCCCCGCCGGCATGCGGGTCCTCGCCGTCGACGATGACCCCGTGTGCCTCAAGGTTCTGGAGGTCCTCCTACGCCGCTGCCAGTATCATGTGACAACCACCAACCAGGCTGCTACTGCACTGAGGCTGTTAAGGGAGAACAAGGACATGTTTGATCTGGTCATCAGCGACGTCCACATGCCCGACATGGACGGCTTCAAGCTCCTCGAGCTCGTGGGGCTCGAAATGGATCTCCCTGTCATCATGTTATCGGTGAACGGAGAGACAAAAACTGTACTGAAGGGGATAACTCATGGTGCCTGTGACTATCTCCTAAAACCAGTTCGCATCGAAGAGCTCCGGAACGTGTGGCAGCACGTTGTGAGGAGAAAATTCTGCAACCGTGAGCCGAACAATCTTGATTTCTGCAAGGACTCATACCACCGGCTCGGCCAGGCGATCTGTGACAGCCACAGGTCGTCTGACCAGAGCAACAGGGCCAGGAGGAAGAGGAAGGAACTGCACAGCGAGGAGGAAGACGAAGGCGAGGACAACGACGACGCCGCGGCGTCGAAGAAGCCGAGGGTGGTGTGGTCAGTGGAGCTGCACCGGAAGTTCGTCGCTGCCGTCAACCAGCTCGGGATCGACAAGGCTGTACCTAAAAGAATACTCGAGCTTATGAACGTGGAGAAGCTCACCAGGGAAAATGTTGCGAGTCATCTGCAGAAACAACCGTTA
Protein Sequence:
- >Traes_7AS_503B57D77.1|Triticum_aestivum|ARR-B|Traes_7AS_503B57D77.1
MLLDAMMMEARKGLMERDQFPAGMRVLAVDDDPVCLKVLEVLLRRCQYHVTTTNQAATALRLLRENKDMFDLVISDVHMPDMDGFKLLELVGLEMDLPVIMLSVNGETKTVLKGITHGACDYLLKPVRIEELRNVWQHVVRRKFCNREPNNLDFCKDSYHRLGQAICDSHRSSDQSNRARRKRKELHSEEEDEGEDNDDAAASKKPRVVWSVELHRKFVAAVNQLGIDKAVPKRILELMNVEKLTRENVASHLQKQPL