Information report for Tp_un0315_001
Gene Details
|
|
Functional Annotation
- Refseq: XP_024012265.1 — putative two-component response regulator ARR21 isoform X1
- Refseq: XP_024012266.1 — putative two-component response regulator ARR21 isoform X2
- Swissprot: Q9LYP5 — ARR21_ARATH; Putative two-component response regulator ARR21
- TrEMBL: V4KRT8 — V4KRT8_EUTSA; Uncharacterized protein
- STRING: XP_006399202.1 — (Eutrema salsugineum)
- GO:0000160 — Biological Process — phosphorelay signal transduction system
- GO:0003677 — Molecular Function — DNA binding
Family Introduction
- The Arabidopsis genome codes for 22 response regulators (ARRs), 12 of which contain a Myb-like DNA binding domain called ARRM (type B). The remainder (type A) possess no apparent functional unit other than a signal receiver domain containing two aspartate and one lysine residues (DDK) at invariant positions, and their genes are transcriptionally induced by cytokinins without de novo protein synthesis. The type B members, ARR1 and ARR2, bind DNA in a sequence-specific manner and work as transcriptional activators.
- Here we present evidence that ARR1 mediates a cytokinin signal, probably through its NH2-terminal signal receiver domain, and transactivates ARR6, which is immediately responsive to cytokinins. A paralogous response regulator, ARR2, shows almost identical characteristics to ARR1, suggesting a functional overlap. Residual cytokinin responses observed with the arr1-1 mutant may have been provided by ARR2. In addition to ARR6, other type A member genes, including ARR4, ARR5, ARR7, ARR8, and ARR9, were also activated by DEX at various levels in 35S::ARR1DDK::GR plants, suggesting that all the immediate cytokinin-responsive genes belonging to this group are directly activated by ARR1. Also, other cytokinin-responsive genes whose promoter regions contain the ARR1 recognition sequences are possibly transactivated by ARR1. A screening for ARR1 target genes using transgenic 35S::ARR1-DDK::GR plants will shed light on the whole view of the early cytokinin signal transduction pathway. We conclude that ARR1 is a principal transcription factor-type response regulator that is involved in an early step of cytokinin signal transduction, possibly as a partner of the sensor histidine kinase CRE1.
Literature and News
Gene Resources
Sequences
CDS Sequence:
- >Tp_un0315_001|Thellungiella_parvula|ARR-B|Tp_un0315_001
ATGGGTTTCTACAACCAAAGCTCTGTGTTGAGAATCAATATTATGGTTGTGGACGATGATCCTGTTTTCCTTCAAATCATCTCACGTATGCTTGAAAAATCCAAATACCGAGATCCATCGATTATGGAGATTACATTTATACCTATAAAAGATTCGAAAGAAGCATTGCCTGCTCTTAAAATGCAAAGAAACAATATCGATCTCGTAATCACAGATTATTACATGCATGTTATATCATCGGACACCACCAAAGAACAAGAGAGTTTAACTTGCAGAGCGATGTGTTTCATTCCAAAACCCATTAAAGCAACTGACCTAACCAAGATTTATCAACTTGTTTTAACTTACAAGAGGAACGGTAAGTCCATAGTATGGACAGACCAGAACCACAAGGACACAGATGTTAGCATCCCTCAGCAAATCCAGTCGCTTCCTGAACAAGCTAATTCCTTGAAGACGAAGTTCTCATCTAGATCGGATACAAGATCCGTGAACAGTTCAAATGGAACTTGCGTTAGTACCGATGGTTCACGAAAGAATCGGAAAAGAAAATCAAATAGTGGTTCCGGTGTTGATGCTGAGTCTATGTCGAAGCCCTCCAAGAAGAATAAGATTTCGTGGGTGGATTCACTTCATGACCTTTTCTTACAAGCTATCCAACATATCGGTCTTGACAAGGCTGTGCCAAAGAAAATCTTAGAGTTCATGAACGTATCATACTTGACAAGAGAGCACGTAGCTAGCCATCTACAGGTACATAAAAAGTTCTTGAGGAAAGTCGCGGAACAAGGTTTTGTCTGTTCAAGCATGTTGCCGGGTAGAGGCATAGAATCGACGTTTCCATTTGCTCAGATCAGAAACCCGTACTATAACAACTACACACCCTCTACTTCTTCGTACGACACAAGTCTTAACAATAGGTCATTCTATTCCAAACCCGGATACTGTCTTGGACAGTCTAGACTTCTATCCAATACAGGTGAGCCTGTCAGCTTCAACCAGTTGCCTTACAACTACATACACTGGTCATCGACCTATGAGCCGCACCGTATTGGATCAAACTTGACCATGCCCATTCAAAGCAACCTCAATTTCTCAACTCAACCATCTCAAGTTCTCGGGTTTGGACATGGACTATCGACTATTAGTGGTAATAGTTTCAACAACAACACGATGAGCAGCTATGAAAGTTCAACTTCTAATCAACTAGGAATGAGCAGCCATGGAAGTTTGACCCTTAATCAACCAGGAATGAGTAGCTATGGAAGTTTAACTTCTATTCAACCAAGA
Protein Sequence:
- >Tp_un0315_001|Thellungiella_parvula|ARR-B|Tp_un0315_001
MGFYNQSSVLRINIMVVDDDPVFLQIISRMLEKSKYRDPSIMEITFIPIKDSKEALPALKMQRNNIDLVITDYYMHVISSDTTKEQESLTCRAMCFIPKPIKATDLTKIYQLVLTYKRNGKSIVWTDQNHKDTDVSIPQQIQSLPEQANSLKTKFSSRSDTRSVNSSNGTCVSTDGSRKNRKRKSNSGSGVDAESMSKPSKKNKISWVDSLHDLFLQAIQHIGLDKAVPKKILEFMNVSYLTREHVASHLQVHKKFLRKVAEQGFVCSSMLPGRGIESTFPFAQIRNPYYNNYTPSTSSYDTSLNNRSFYSKPGYCLGQSRLLSNTGEPVSFNQLPYNYIHWSSTYEPHRIGSNLTMPIQSNLNFSTQPSQVLGFGHGLSTISGNSFNNNTMSSYESSTSNQLGMSSHGSLTLNQPGMSSYGSLTSIQPR