Information report for Psi003276
Gene Details
Functional Annotation
- Refseq: XP_006849799.1 — two-component response regulator ORR21 isoform X1
- Refseq: XP_011625385.1 — two-component response regulator ORR21 isoform X2
- Swissprot: A2XE31 — ORR21_ORYSI; Two-component response regulator ORR21
- Swissprot: Q8H7S7 — ORR21_ORYSJ; Two-component response regulator ORR21
- TrEMBL: A0A0D6R4K9 — A0A0D6R4K9_ARACU; Uncharacterized protein
- STRING: ERN11380 — (Amborella trichopoda)
- GO:0000160 — Biological Process — phosphorelay signal transduction system
- GO:0003677 — Molecular Function — DNA binding
- GO:0003700 — Molecular Function — transcription factor activity, sequence-specific DNA binding
Family Introduction
- The Arabidopsis genome codes for 22 response regulators (ARRs), 12 of which contain a Myb-like DNA binding domain called ARRM (type B). The remainder (type A) possess no apparent functional unit other than a signal receiver domain containing two aspartate and one lysine residues (DDK) at invariant positions, and their genes are transcriptionally induced by cytokinins without de novo protein synthesis. The type B members, ARR1 and ARR2, bind DNA in a sequence-specific manner and work as transcriptional activators.
- Here we present evidence that ARR1 mediates a cytokinin signal, probably through its NH2-terminal signal receiver domain, and transactivates ARR6, which is immediately responsive to cytokinins. A paralogous response regulator, ARR2, shows almost identical characteristics to ARR1, suggesting a functional overlap. Residual cytokinin responses observed with the arr1-1 mutant may have been provided by ARR2. In addition to ARR6, other type A member genes, including ARR4, ARR5, ARR7, ARR8, and ARR9, were also activated by DEX at various levels in 35S::ARR1DDK::GR plants, suggesting that all the immediate cytokinin-responsive genes belonging to this group are directly activated by ARR1. Also, other cytokinin-responsive genes whose promoter regions contain the ARR1 recognition sequences are possibly transactivated by ARR1. A screening for ARR1 target genes using transgenic 35S::ARR1-DDK::GR plants will shed light on the whole view of the early cytokinin signal transduction pathway. We conclude that ARR1 is a principal transcription factor-type response regulator that is involved in an early step of cytokinin signal transduction, possibly as a partner of the sensor histidine kinase CRE1.
Literature and News
Gene Resources
Sequences
CDS Sequence:
- >Psi003276|Picea_sitchensis|ARR-B|gnl|UG|Psi#S26040737;PUT-183a-Picea_sitchensis-1554
ATGGTGATGATGCCTGCACACGACTCTGTGACCAGCAGTATGAGCATGAGCACGGGCAACAGCTATGGAGGTGGGAAAGCAGATCATCAGTTCCCTGCAGGACTCAGAGTACTAGTGGTTGATGACGACCCCACATGCCTGAAGATCCTTGATAAAATGCTCAGGAGGTGCCTCTACCAAGTTACAACATGTTGTCGTGCTACAGCTGCATTATCAATGCTTCGAGAGAAGAAAGGTGCGTTTGATCTAGTCATAAGTGATGTTTATATGCCAGATATGGATGGCTTCAAGCTCCTTGAGCATGTTGGACTGGAAATGGACTTGCCTGTCATCATGATGTCAGCAGACGGAGGAACAAGTACAGTTATGAAAGGAATCAAGCATGGGGCTTGTGATTACTTGATAAAACCTGTACGCCTAGAGGAGCTTAAGAACATATGGCAGCATGTGATTAGAAAGAAAAGGAATGAGCCAAAAGATTTTGATCCTTCTGGTAGTTTTGAAGACAATGACAGGCACAGAAAAGGATCTGATGATGTTGATTATGCTTCCTCAGTGAATGAAGGAACAGATGGTAATTGGAAACTTCTAAAAAAGAGGAAGGAAGCTAAGGAGGAAGAAGATGATGGGGAAGAGGACAATGACGATCCATCTGCCTCAAAGAAACCACGGGTAGTCTGGTCTGTAGAGCTCCATCAACAATTTGTCAATGCTGTGAATCAGCTGGGAATCGATAAGGCTGTTCCCAAGCGGATACTTGAATTGATGCATGTTCAAGGGCTTACAAGGGAGAATGTTGCAAGCCACCTGCAGAAATATAGGCTATATCTGAAAAAAANN
Protein Sequence:
- >Psi003276|Picea_sitchensis|ARR-B|gnl|UG|Psi#S26040737;PUT-183a-Picea_sitchensis-1554
MVMMPAHDSVTSSMSMSTGNSYGGGKADHQFPAGLRVLVVDDDPTCLKILDKMLRRCLYQVTTCCRATAALSMLREKKGAFDLVISDVYMPDMDGFKLLEHVGLEMDLPVIMMSADGGTSTVMKGIKHGACDYLIKPVRLEELKNIWQHVIRKKRNEPKDFDPSGSFEDNDRHRKGSDDVDYASSVNEGTDGNWKLLKKRKEAKEEEDDGEEDNDDPSASKKPRVVWSVELHQQFVNAVNQLGIDKAVPKRILELMHVQGLTRENVASHLQKYRLYLKKX