Information report for PEQU_04699
Gene Details
|
|
Functional Annotation
- Refseq: XP_020578712.1 — two-component response regulator ORR23-like isoform X1
- Refseq: XP_020578714.1 — two-component response regulator ARR18-like isoform X3
- Refseq: XP_020578715.1 — two-component response regulator ARR18-like isoform X4
- Refseq: XP_020578716.1 — two-component response regulator ARR18-like isoform X4
- Refseq: XP_020578717.1 — two-component response regulator ARR18-like isoform X5
- Swissprot: B8AEH1 — ORR23_ORYSI; Two-component response regulator ORR23
- Swissprot: Q6K8X6 — ORR23_ORYSJ; Two-component response regulator ORR23
- TrEMBL: A0A2I0W9B1 — A0A2I0W9B1_9ASPA; Two-component response regulator ARR10
- STRING: EOY29602 — (Theobroma cacao)
- STRING: evm.model.supercontig_127.10 — (Carica papaya)
- STRING: GSMUA_Achr10P23650_001 — (Musa acuminata)
- GO:0000160 — Biological Process — phosphorelay signal transduction system
- GO:0003677 — Molecular Function — DNA binding
Family Introduction
- The Arabidopsis genome codes for 22 response regulators (ARRs), 12 of which contain a Myb-like DNA binding domain called ARRM (type B). The remainder (type A) possess no apparent functional unit other than a signal receiver domain containing two aspartate and one lysine residues (DDK) at invariant positions, and their genes are transcriptionally induced by cytokinins without de novo protein synthesis. The type B members, ARR1 and ARR2, bind DNA in a sequence-specific manner and work as transcriptional activators.
- Here we present evidence that ARR1 mediates a cytokinin signal, probably through its NH2-terminal signal receiver domain, and transactivates ARR6, which is immediately responsive to cytokinins. A paralogous response regulator, ARR2, shows almost identical characteristics to ARR1, suggesting a functional overlap. Residual cytokinin responses observed with the arr1-1 mutant may have been provided by ARR2. In addition to ARR6, other type A member genes, including ARR4, ARR5, ARR7, ARR8, and ARR9, were also activated by DEX at various levels in 35S::ARR1DDK::GR plants, suggesting that all the immediate cytokinin-responsive genes belonging to this group are directly activated by ARR1. Also, other cytokinin-responsive genes whose promoter regions contain the ARR1 recognition sequences are possibly transactivated by ARR1. A screening for ARR1 target genes using transgenic 35S::ARR1-DDK::GR plants will shed light on the whole view of the early cytokinin signal transduction pathway. We conclude that ARR1 is a principal transcription factor-type response regulator that is involved in an early step of cytokinin signal transduction, possibly as a partner of the sensor histidine kinase CRE1.
Literature and News
Gene Resources
Homologs
- Arachis hypogaea: Ahy021284
- Capsicum annuum: CA09g18440
- Cucumis melo: MELO3C016975P1
- Cucumis sativus: Cucsa.271670.1
- Gossypium arboreum: Cotton_A_01261_BGI-A2_v1.0
- Gossypium hirsutum: Gh_D05G0524, Gh_A05G0407
- Manihot esculenta: Manes.16G127500.1.p
- Musa acuminata: GSMUA_Achr10P23650_001
- Sesamum indicum: XP_011078598.1, XP_011084015.1
- Solanum lycopersicum: Solyc12g010330.1.1
- Solanum tuberosum: PGSC0003DMP400013790, PGSC0003DMP400013791
Sequences
CDS Sequence:
- >PEQU_04699|Phalaenopsis_equestris|ARR-B|PEQU_04699
ATGCCGGACATGGACGGGTTTAAGCTTTTGGAGATAGTGGGCCTTGAGATGGACTTGCCTGTTATTATGCTCTCTGTTGACTGCGATGTCAAGAATGTTATGAAAGGAATAATGCATGGTGCAGTGGACTATCTTGCCAAGCCTGTGAGGCTTGAGGAGCTGAAGCTTATCTGGAAACATGTGGTTCGGAGATCACTTAATGAAAAAAAGGATCAAAATGTTACTAATAAACAACTCGGTCATGCAACTAAGTCAGAAGAAGATCAAAAATTGCGCCACACAAAAAAATGCAAGGGTCATAATAAGGAAAGTGATAATGAGGTTTGTGCAGACTCCGATGAAGACATGAATCCACAAAAGAAACCAAGAGTTACTTGGTCACCAGAATTGCATGTCAAATTTATAAATATTGTAAACCAATTGGGCATAAGCAGGGCAGCTCCAAAGAAGATTCTTGATATGTTGAACATCTCGGGACTCACCCGAGAGAATGTGGCTAGTCATTTACAGGTTTGCTCATGA
Protein Sequence:
- >PEQU_04699|Phalaenopsis_equestris|ARR-B|PEQU_04699
MPDMDGFKLLEIVGLEMDLPVIMLSVDCDVKNVMKGIMHGAVDYLAKPVRLEELKLIWKHVVRRSLNEKKDQNVTNKQLGHATKSEEDQKLRHTKKCKGHNKESDNEVCADSDEDMNPQKKPRVTWSPELHVKFINIVNQLGISRAAPKKILDMLNISGLTRENVASHLQVCS