Information report for MELO3C004489P1
Gene Details
|
|
Functional Annotation
- Refseq: XP_008457369.1 — PREDICTED: two-component response regulator ARR12-like
- Swissprot: A2X1N2 — ORR24_ORYSI; Two-component response regulator ORR24
- Swissprot: Q6H805 — ORR24_ORYSJ; Two-component response regulator ORR24
- TrEMBL: A0A1S3C613 — A0A1S3C613_CUCME; two-component response regulator ARR12-like
- STRING: XP_008457369.1 — (Cucumis melo)
- GO:0000160 — Biological Process — phosphorelay signal transduction system
- GO:0003677 — Molecular Function — DNA binding
- GO:0003700 — Molecular Function — transcription factor activity, sequence-specific DNA binding
Family Introduction
- The Arabidopsis genome codes for 22 response regulators (ARRs), 12 of which contain a Myb-like DNA binding domain called ARRM (type B). The remainder (type A) possess no apparent functional unit other than a signal receiver domain containing two aspartate and one lysine residues (DDK) at invariant positions, and their genes are transcriptionally induced by cytokinins without de novo protein synthesis. The type B members, ARR1 and ARR2, bind DNA in a sequence-specific manner and work as transcriptional activators.
- Here we present evidence that ARR1 mediates a cytokinin signal, probably through its NH2-terminal signal receiver domain, and transactivates ARR6, which is immediately responsive to cytokinins. A paralogous response regulator, ARR2, shows almost identical characteristics to ARR1, suggesting a functional overlap. Residual cytokinin responses observed with the arr1-1 mutant may have been provided by ARR2. In addition to ARR6, other type A member genes, including ARR4, ARR5, ARR7, ARR8, and ARR9, were also activated by DEX at various levels in 35S::ARR1DDK::GR plants, suggesting that all the immediate cytokinin-responsive genes belonging to this group are directly activated by ARR1. Also, other cytokinin-responsive genes whose promoter regions contain the ARR1 recognition sequences are possibly transactivated by ARR1. A screening for ARR1 target genes using transgenic 35S::ARR1-DDK::GR plants will shed light on the whole view of the early cytokinin signal transduction pathway. We conclude that ARR1 is a principal transcription factor-type response regulator that is involved in an early step of cytokinin signal transduction, possibly as a partner of the sensor histidine kinase CRE1.
Literature and News
Gene Resources
Homologs
- Cajanus cajan: C.cajan_22328
- Citrullus lanatus: Cla016659
- Citrus sinensis: orange1.1g005719m
- Cucumis sativus: Cucsa.132590.1
- Gossypium arboreum: Cotton_A_01261_BGI-A2_v1.0
- Gossypium hirsutum: Gh_A05G0407, Gh_D05G0524, Gh_A07G0197, Gh_D07G0251, Gh_D08G2618, Gh_A08G2252
- Lotus japonicus: Lj6g3v1078590.1
- Manihot esculenta: Manes.06G038500.1.p
- Petunia inflata: Peinf101Scf00586g11030.1
- Sesamum indicum: XP_011078598.1
- Solanum melongena: Sme2.5_03790.1_g00001.1
- Ziziphus jujuba: XP_015892878.1
Sequences
CDS Sequence:
- >MELO3C004489P1|Cucumis_melo|ARR-B|MELO3C004489P1
ATGACTGTGGAGGTTCGAAAGACTAATTTAGTTGGTGAAAATGATGATATGGAGCAGTTTCCTATTGGTATGCGTGTTCTTGCTGTAGATGATGACCCCATTTGCCTTAAGGTTTTGGAGAATTTGCTTCGTAAATGTCAATATCATGTTACAACGACCAATCAGGCAGTTCAGGCACTTAAAATGTTGAGGGAGAACAAAAACAGGTTTGACCTGGTTATCAGCGATGTTAACATGCCCGACATGGATGGTTTTAAGCTCCTTGAGCTAGTAGGCCTTGAAATGGACCTACCTGTTATAATGTTGTCTGCGCATAGCAATACTGAACTCGTAAAGAAGGGAGTTATTCATGGTGCATGCGACTATTTGCTGAAACCTGTTCGAATTGAAGAACTGAAGAATATATGGCAACATGTCCTTCGGAGAAAGAAACCTTCTGTTAAGAACCAAAATAAGAGCATTAATGGAAATAACACTAGTCAAGGTGTTGAAGTTGCAAAAGGTTGTCCACCTGCAGTCAGTACTGATAACGAGAAATCTGGTAAAAGACAGAAAGACCAAGATGATGACGAGGAAGGAGGTGAAGAAGACAGTACTTACGAGAATGACGATTCCTCCACCCAAAAAAAGCCAAGAGTAAATTGGTACGATGGAGATGAGAATTTGCACAGGAAGTTTGTGGCAGCTGTTAACATTTTGGGCTATGAAAAGGCTGTTCCCAAGAAGATCCTTGATCTGATGAATGTTGAAGGACTTACAAGAGAAAATGTGGCCAGCCATCTTCAGGCATTGATCATTCTCCTACCTTTTGTTATAATTTCATTGGCTTTGCACTTTAAACTTCCACGAGTGACATATTGA
Protein Sequence:
- >MELO3C004489P1|Cucumis_melo|ARR-B|MELO3C004489P1
MTVEVRKTNLVGENDDMEQFPIGMRVLAVDDDPICLKVLENLLRKCQYHVTTTNQAVQALKMLRENKNRFDLVISDVNMPDMDGFKLLELVGLEMDLPVIMLSAHSNTELVKKGVIHGACDYLLKPVRIEELKNIWQHVLRRKKPSVKNQNKSINGNNTSQGVEVAKGCPPAVSTDNEKSGKRQKDQDDDEEGGEEDSTYENDDSSTQKKPRVNWYDGDENLHRKFVAAVNILGYEKAVPKKILDLMNVEGLTRENVASHLQALIILLPFVIISLALHFKLPRVTY*