Information report for estExt_Genewise1.C_90203
Gene Details
|
|
Functional Annotation
- Refseq: XP_005848101.1 — hypothetical protein CHLNCDRAFT_30989, partial
- Swissprot: Q9ZWJ9 — ARR2_ARATH; Two-component response regulator ARR2
- TrEMBL: E1ZEB2 — E1ZEB2_CHLVA; Uncharacterized protein (Fragment)
- STRING: XP_005848101.1 — (Chlorella variabilis)
- GO:0009736 — Biological Process — cytokinin-activated signaling pathway
- GO:0009873 — Biological Process — ethylene-activated signaling pathway
- GO:0010082 — Biological Process — regulation of root meristem growth
- GO:0010119 — Biological Process — regulation of stomatal movement
- GO:0010150 — Biological Process — leaf senescence
- GO:0045893 — Biological Process — positive regulation of transcription, DNA-templated
- GO:0080113 — Biological Process — regulation of seed growth
- GO:0005634 — Cellular Component — nucleus
- GO:0003700 — Molecular Function — transcription factor activity, sequence-specific DNA binding
- GO:0043565 — Molecular Function — sequence-specific DNA binding
Family Introduction
- The Arabidopsis genome codes for 22 response regulators (ARRs), 12 of which contain a Myb-like DNA binding domain called ARRM (type B). The remainder (type A) possess no apparent functional unit other than a signal receiver domain containing two aspartate and one lysine residues (DDK) at invariant positions, and their genes are transcriptionally induced by cytokinins without de novo protein synthesis. The type B members, ARR1 and ARR2, bind DNA in a sequence-specific manner and work as transcriptional activators.
- Here we present evidence that ARR1 mediates a cytokinin signal, probably through its NH2-terminal signal receiver domain, and transactivates ARR6, which is immediately responsive to cytokinins. A paralogous response regulator, ARR2, shows almost identical characteristics to ARR1, suggesting a functional overlap. Residual cytokinin responses observed with the arr1-1 mutant may have been provided by ARR2. In addition to ARR6, other type A member genes, including ARR4, ARR5, ARR7, ARR8, and ARR9, were also activated by DEX at various levels in 35S::ARR1DDK::GR plants, suggesting that all the immediate cytokinin-responsive genes belonging to this group are directly activated by ARR1. Also, other cytokinin-responsive genes whose promoter regions contain the ARR1 recognition sequences are possibly transactivated by ARR1. A screening for ARR1 target genes using transgenic 35S::ARR1-DDK::GR plants will shed light on the whole view of the early cytokinin signal transduction pathway. We conclude that ARR1 is a principal transcription factor-type response regulator that is involved in an early step of cytokinin signal transduction, possibly as a partner of the sensor histidine kinase CRE1.
Literature and News
Gene Resources
Homologs
- Arabidopsis thaliana: AT4G16110.1
- Arachis hypogaea: Ahy012644
- Brassica napus: GSBRNA2T00101896001
- Juglans regia: WALNUT_00003762-RA
- Lactuca sativa: Lsa013079
- Salvia miltiorrhiza: SMil_00008695-RA_Salv
- Sesamum indicum: XP_011100814.1, XP_011100813.1, XP_011100812.1
Sequences
CDS Sequence:
- >estExt_Genewise1.C_90203|Chlorella_variabilis_NC64A|ARR-B|estExt_Genewise1.C_90203
ATGGACCTCGCTGGGGAGGGCAGCAGCGGGGACAACACCAACAATGCAGCCGCTAGCAGCTCCGGAGCCACCGACTGTGGCCTGTTTTCTCCCTCGGGGCTCAAGGTGCTGGTGGTAGATGACGATCCGATGTGCTTGAAAGTGGTGTCGGCCATGCTGCAGCGGTGCAACTACGAAGTTGACACGCGGACCAGCGGGCAGGACGCGCTGCTGCTGCTGCGGGACCGGCAGGAGCACAACCACCAGTTTGACCTGGTGCTGTCGGACGTCTACATGCCAGACATGGACGGCTTCAAGCTGCTGGAGCACATCGGGCTGGAGCTGGACCTGCCGGTCATCATGATGTCCTCCAACGGCGACACCGACGTCGTGCTGCGCGGCGTGACGCACGGCGCCGTCGACTTCCTCATCAAGCCTGTGCGGGTGGAGGAGCTGCGCAACGTGTGGCAGCACGTGGTGCGACGCCGCTCGCTGCACGTCGGCCGCGCCTCGGACGAGCACTCGGGGCTGGACCTGGAGCAGCACCAGCACCACCACGGCGTGAAGCGCAAGGAGGTGGAGGCGCTGCAGGTGCAGCACGAGACGCAGGGGGCCAACAAGAAGCCGCGGGTGGTGTGGAGTGTGGAGATGCACCAGCAGTTTGTGGATGCCGTGAATCAGCTGGGCGTGGACAAGGCTGTGCCCAAGCGCATCCTGGACCTGATGAATGTGGAGGGTCTGACGCGTGAGAATGTGGCCAGCCACCTTCAGAAGTACCGCCTGTACCTCAAGCGCGCGCAGGGCCTGCAGAGCGGCAAGGGCTCCAAGGGGCACAAGGCGGCACAGGAGGCGGCCATGCTGGACCCGCAGGCGGCGGCGGCGGCGGCGGCGGTGGCCGCCGGCGCAGGCCCCTCCTCCGTCTTTGCCCAGGTGGCCGCGCAGCAGGCGGCGATGGGCGGCGGCGCGGGCCTGGGGCAGCCAGGCATGGCGCAGGCGGGGATGCCGGTGATGGGCATGCCGGGG
Protein Sequence:
- >estExt_Genewise1.C_90203|Chlorella_variabilis_NC64A|ARR-B|estExt_Genewise1.C_90203
MDLAGEGSSGDNTNNAAASSSGATDCGLFSPSGLKVLVVDDDPMCLKVVSAMLQRCNYEVDTRTSGQDALLLLRDRQEHNHQFDLVLSDVYMPDMDGFKLLEHIGLELDLPVIMMSSNGDTDVVLRGVTHGAVDFLIKPVRVEELRNVWQHVVRRRSLHVGRASDEHSGLDLEQHQHHHGVKRKEVEALQVQHETQGANKKPRVVWSVEMHQQFVDAVNQLGVDKAVPKRILDLMNVEGLTRENVASHLQKYRLYLKRAQGLQSGKGSKGHKAAQEAAMLDPQAAAAAAAVAAGAGPSSVFAQVAAQQAAMGGGAGLGQPGMAQAGMPVMGMPG