Information report for cra_locus_7074_iso_4
Gene Details
|
|
Functional Annotation
- Refseq: XP_027115945.1 — two-component response regulator ARR2-like
- Swissprot: Q940D0 — ARR1_ARATH; Two-component response regulator ARR1
- TrEMBL: Q71BZ1 — Q71BZ1_CATRO; Two-component response regulator
- STRING: Solyc05g054390.2.1 — (Solanum lycopersicum)
- STRING: XP_009591694.1 — (Nicotiana tomentosiformis)
- GO:0000160 — Biological Process — phosphorelay signal transduction system
- GO:0006355 — Biological Process — regulation of transcription, DNA-templated
- GO:0009414 — Biological Process — response to water deprivation
- GO:0010082 — Biological Process — regulation of root meristem growth
- GO:0010380 — Biological Process — regulation of chlorophyll biosynthetic process
- GO:0031537 — Biological Process — regulation of anthocyanin metabolic process
- GO:0048367 — Biological Process — shoot system development
- GO:0080022 — Biological Process — primary root development
- GO:0080036 — Biological Process — regulation of cytokinin-activated signaling pathway
- GO:0080113 — Biological Process — regulation of seed growth
- GO:0005634 — Cellular Component — nucleus
- GO:0003677 — Molecular Function — DNA binding
- GO:0003700 — Molecular Function — transcription factor activity, sequence-specific DNA binding
Family Introduction
- The Arabidopsis genome codes for 22 response regulators (ARRs), 12 of which contain a Myb-like DNA binding domain called ARRM (type B). The remainder (type A) possess no apparent functional unit other than a signal receiver domain containing two aspartate and one lysine residues (DDK) at invariant positions, and their genes are transcriptionally induced by cytokinins without de novo protein synthesis. The type B members, ARR1 and ARR2, bind DNA in a sequence-specific manner and work as transcriptional activators.
- Here we present evidence that ARR1 mediates a cytokinin signal, probably through its NH2-terminal signal receiver domain, and transactivates ARR6, which is immediately responsive to cytokinins. A paralogous response regulator, ARR2, shows almost identical characteristics to ARR1, suggesting a functional overlap. Residual cytokinin responses observed with the arr1-1 mutant may have been provided by ARR2. In addition to ARR6, other type A member genes, including ARR4, ARR5, ARR7, ARR8, and ARR9, were also activated by DEX at various levels in 35S::ARR1DDK::GR plants, suggesting that all the immediate cytokinin-responsive genes belonging to this group are directly activated by ARR1. Also, other cytokinin-responsive genes whose promoter regions contain the ARR1 recognition sequences are possibly transactivated by ARR1. A screening for ARR1 target genes using transgenic 35S::ARR1-DDK::GR plants will shed light on the whole view of the early cytokinin signal transduction pathway. We conclude that ARR1 is a principal transcription factor-type response regulator that is involved in an early step of cytokinin signal transduction, possibly as a partner of the sensor histidine kinase CRE1.
Literature and News
Gene Resources
Homologs
- Actinidia chinensis: Achn103181
- Nicotiana tabacum: XP_016486380.1
- Petunia inflata: Peinf101Scf02621g01040.1, Peinf101Scf01050g07020.1
- Prunus mume: XP_008223287.1, XP_008223286.1
- Prunus persica: Prupe.1G126400.2.p, Prupe.1G126400.1.p
- Sesamum indicum: XP_011071400.1, XP_011071399.1, XP_011100813.1, XP_011100812.1
- Solanum lycopersicum: Solyc05g054390.2.1, Solyc01g065540.2.1
- Solanum melongena: Sme2.5_04775.1_g00009.1
- Solanum tuberosum: PGSC0003DMP400040747, PGSC0003DMP400044406
Sequences
CDS Sequence:
- >cra_locus_7074_iso_4|Catharanthus_roseus|ARR-B|cra_locus_7074_iso_4
Protein Sequence:
- >cra_locus_7074_iso_4|Catharanthus_roseus|ARR-B|cra_locus_7074_iso_4
MNLGGGQLVKSMAVPSSSASWKSGGDGVSDQFPAGLRVLVVDDDPTCLRILEKMLKNCLYEVTKCNRAEIALKLLRDNRNGYDIVISDVHMPDMDGFKLLEQVGLEMDLPVIMMSADDSKNVVMKGVTHGACDYLIKPVRIEALKNIWQHVVRKRKHEWKEKDYEQSGSVEDGERQQKPNEDVDYSSSANEGNWKNSKKRKDDEEDQEEKDDSSTLKKPRVVWSVELHQQFVAAVNQLGIDKAVPKKILELMNVPGLTRENVASHLQKYRLYLRRVSGVSQHQNGLNNSFMGTPDATFGSMSSINGLDFQALAATGQIPAQSLASLQAAAIGRPTSKPTISMPVVDQRNLFSFEPHKLRFGEGQQQLNGHTKQISLLHGIPTNMEPKQLASLNQSAQTFGGINMQVSSQASQGNTLLMQMTQPMSRAPMLNENNASQISRLPSSVGQAILSNGIPSGVLGRNGIVDSVRGPVYTPVSQTSSLVDFSVSNSAELPGSTFPHASNSGISSLTPKGMMQEEVNSEGKGSRGFPSSYDIFSELQQHKTQDWGLQNVGSTFDGTQHSSIQGSLEGGQNNPPNFGQQFSSYMVDNSLRIKSERHPDANCQTNLFPQQFGQDDLMSALLKQEGIGSVESDFGFDGYALDL