Information report for Cla018819
Gene Details
Functional Annotation
- Refseq: XP_011648496.1 — PREDICTED: two-component response regulator ARR10-like
- TrEMBL: A0A0A0LU42 — A0A0A0LU42_CUCSA; Uncharacterized protein
- STRING: XP_008453705.1 — (Cucumis melo)
- GO:0000160 — Biological Process — phosphorelay signal transduction system
- GO:0003677 — Molecular Function — DNA binding
Family Introduction
- The Arabidopsis genome codes for 22 response regulators (ARRs), 12 of which contain a Myb-like DNA binding domain called ARRM (type B). The remainder (type A) possess no apparent functional unit other than a signal receiver domain containing two aspartate and one lysine residues (DDK) at invariant positions, and their genes are transcriptionally induced by cytokinins without de novo protein synthesis. The type B members, ARR1 and ARR2, bind DNA in a sequence-specific manner and work as transcriptional activators.
- Here we present evidence that ARR1 mediates a cytokinin signal, probably through its NH2-terminal signal receiver domain, and transactivates ARR6, which is immediately responsive to cytokinins. A paralogous response regulator, ARR2, shows almost identical characteristics to ARR1, suggesting a functional overlap. Residual cytokinin responses observed with the arr1-1 mutant may have been provided by ARR2. In addition to ARR6, other type A member genes, including ARR4, ARR5, ARR7, ARR8, and ARR9, were also activated by DEX at various levels in 35S::ARR1DDK::GR plants, suggesting that all the immediate cytokinin-responsive genes belonging to this group are directly activated by ARR1. Also, other cytokinin-responsive genes whose promoter regions contain the ARR1 recognition sequences are possibly transactivated by ARR1. A screening for ARR1 target genes using transgenic 35S::ARR1-DDK::GR plants will shed light on the whole view of the early cytokinin signal transduction pathway. We conclude that ARR1 is a principal transcription factor-type response regulator that is involved in an early step of cytokinin signal transduction, possibly as a partner of the sensor histidine kinase CRE1.
Literature and News
Gene Resources
Homologs
- Actinidia chinensis: Achn311481, Achn185011
- Beta vulgaris: Bv2_031200_qerp.t1, Bv2_031200_qerp.t2
- Cucumis melo: MELO3C017472P1
- Cucumis sativus: Cucsa.092420.1, Cucsa.092430.1
- Populus trichocarpa: Potri.018G094700.1
- Triticum aestivum: Traes_7BS_17C8D2707.1, Traes_7AS_503B57D77.1, Traes_7DS_327FBC2CA.2, Traes_7DS_22DE624A5.1
Sequences
CDS Sequence:
- >Cla018819|Citrullus_lanatus|ARR-B|Cla018819
ATGGAAGATTTTGATAATTCAATTCCAAATCCCATTCCATTAAAATCCGAAGAAGATGATCAATTTCCTATTGGTTTGAAAGTGCTTGCAATTGATGCCAATATTGTATGCCTTCATTATCTCGTTCGACTCCTTCAAAAGTGTCAATATAAAGTAAGTGCAACAACAGAAGCAGCGGAAGCAATTAGACTAATAAAGGATGAGAAATTTGATCTGGTTATTACCAATGTTATCCGACACGACATGGATGGCTTCAAAATCCTTCAAATTATTGGTGTCGGAATGGATATTCCAGTTGTTATGGTGTCCGCTAATGATGAATTGGAGACGGTGAAGAGGGGAGTTATGGAGGGAGCTGAGGATTATTTACTAAAGCCAGTTAGAATACAAGAATTGAGAAATATTTGGCAACATGTTTTGCGCAAAAGATCAGCTCGTAAAAGATCAAACCCAAATCTTTTGCTTTTGGAACAAGCTGTAGTACAAGACGAAGATCATAACTCCATTGAAAGGGTTACAATTTCAATGGATAAGCTAGATTATGAGAATGATCAGATTGTTAAATTAGATGATATTAATATTGTTGCTTCATCTTCTTCTAAGAAGAAGCAACGAGTAAGTTGGACAAAGGAATTGCATGAAAAGTTTGTTGAAGCTTATGAGCAATTGAGAGAAAAGGAGAGAGTCCCAAATAATATATTGAAGCTCATGAACGATCCGAGCTTGACACGGGAGAACGTGGCAAGTCATCTTCAGTTCCCCAATCGGGCAAGATCGTCAATGGAAGGACTGCAAGGAATTCAAAACCCTCAATCGACCTGGACGGCGGCCGGAAGTTGCTTTCCCTTGCCTGAATTCAAATGGTTTAATTTTCCATCCAATAATTCCATTTCAAATCCATGTGACGATAATGAGCAACACTTTGGAGGATTTGACCCAATTAACATTAATTCCACCTATTATCCTCCATTGGAAACTAATTGCAATAATTTGAATGCATATAATTCTCCAAGTTTCGTTGGGAATTATGCAATTGAAAATCATAATTATGTTGATGCAGGACAATGTTATCCAATGCAATTTAATGCTGGAAATTCCCTCGGAAGCTTATTAATGGATGACGACCTCGCTGACATTTTCAAATAA
Protein Sequence:
- >Cla018819|Citrullus_lanatus|ARR-B|Cla018819
MEDFDNSIPNPIPLKSEEDDQFPIGLKVLAIDANIVCLHYLVRLLQKCQYKVSATTEAAEAIRLIKDEKFDLVITNVIRHDMDGFKILQIIGVGMDIPVVMVSANDELETVKRGVMEGAEDYLLKPVRIQELRNIWQHVLRKRSARKRSNPNLLLLEQAVVQDEDHNSIERVTISMDKLDYENDQIVKLDDINIVASSSSKKKQRVSWTKELHEKFVEAYEQLREKERVPNNILKLMNDPSLTRENVASHLQFPNRARSSMEGLQGIQNPQSTWTAAGSCFPLPEFKWFNFPSNNSISNPCDDNEQHFGGFDPININSTYYPPLETNCNNLNAYNSPSFVGNYAIENHNYVDAGQCYPMQFNAGNSLGSLLMDDDLADIFK