Information report for Cc11_g07710
Gene Details
|
|
Functional Annotation
- Refseq: XP_027096467.1 — two-component response regulator ORR21-like isoform X1
- Refseq: XP_027099453.1 — two-component response regulator ORR21-like isoform X1
- Refseq: XP_027099994.1 — two-component response regulator ORR21-like isoform X1
- Refseq: XP_027152342.1 — two-component response regulator ORR21-like
- Swissprot: A2XE31 — ORR21_ORYSI; Two-component response regulator ORR21
- Swissprot: Q8H7S7 — ORR21_ORYSJ; Two-component response regulator ORR21
- TrEMBL: A0A068V6K6 — A0A068V6K6_COFCA; Uncharacterized protein
- STRING: XP_010274996.1 — (Nelumbo nucifera)
- GO:0000160 — Biological Process — phosphorelay signal transduction system
- GO:0006355 — Biological Process — regulation of transcription, DNA-templated
- GO:0005634 — Cellular Component — nucleus
- GO:0003677 — Molecular Function — DNA binding
- GO:0003700 — Molecular Function — transcription factor activity, sequence-specific DNA binding
Family Introduction
- The Arabidopsis genome codes for 22 response regulators (ARRs), 12 of which contain a Myb-like DNA binding domain called ARRM (type B). The remainder (type A) possess no apparent functional unit other than a signal receiver domain containing two aspartate and one lysine residues (DDK) at invariant positions, and their genes are transcriptionally induced by cytokinins without de novo protein synthesis. The type B members, ARR1 and ARR2, bind DNA in a sequence-specific manner and work as transcriptional activators.
- Here we present evidence that ARR1 mediates a cytokinin signal, probably through its NH2-terminal signal receiver domain, and transactivates ARR6, which is immediately responsive to cytokinins. A paralogous response regulator, ARR2, shows almost identical characteristics to ARR1, suggesting a functional overlap. Residual cytokinin responses observed with the arr1-1 mutant may have been provided by ARR2. In addition to ARR6, other type A member genes, including ARR4, ARR5, ARR7, ARR8, and ARR9, were also activated by DEX at various levels in 35S::ARR1DDK::GR plants, suggesting that all the immediate cytokinin-responsive genes belonging to this group are directly activated by ARR1. Also, other cytokinin-responsive genes whose promoter regions contain the ARR1 recognition sequences are possibly transactivated by ARR1. A screening for ARR1 target genes using transgenic 35S::ARR1-DDK::GR plants will shed light on the whole view of the early cytokinin signal transduction pathway. We conclude that ARR1 is a principal transcription factor-type response regulator that is involved in an early step of cytokinin signal transduction, possibly as a partner of the sensor histidine kinase CRE1.
Literature and News
Gene Resources
Homologs
- Actinidia chinensis: Achn163021
- Artemisia annua: Aan015157
- Citrus sinensis: orange1.1g007601m, orange1.1g006775m, orange1.1g006774m, orange1.1g006759m, orange1.1g006661m, orange1.1g006044m, orange1.1g006649m, orange1.1g005938m
- Manihot esculenta: Manes.17G084600.1.p
- Nicotiana benthamiana: Niben101Scf04568g01008.1
- Nicotiana tabacum: XP_016484729.1
- Populus trichocarpa: Potri.008G135500.1, Potri.010G105600.1
- Sesamum indicum: XP_011070559.1
- Vitis vinifera: GSVIVT01011650001
Sequences
CDS Sequence:
- >Cc11_g07710|Coffea_canephora|ARR-B|Cc11_g07710
ATGGCGACTGCTTGCAAGGAGGCCTTGCCTGTGCCGCTGCCGTTTCCGGCGGGGTTAAAGGTGTTGGTGGTAGATGATGACTTAACCTGCTTGAAAATTCTTGAACAAATGCTTACCAGGTGCATGTACAGGGTTACCACTTGTTCCCAGGCTACTGTTGCCTTGAATCTCTTAAGGGAAAAGAAAGGATTTTTTGATATTGTACTAAGTGAAGTCCATGTGCCCGATATGGATGGCTTTAAACTTCTTGAGCTCGTTAGTTTGGAAATGAACCTGCCCGTCATAATGATGTCTGTAGATGACAGAACAAGCATCGTTGTGAAGGGAATTATGCAGGGGGCTTGTGATTATCTGATTAAACCAATACGCTTCGAAGAGTTAAAGAATATCTGGCAGCATGTAGTTAGGAAGAGATGCAATAAGGGGAAAGAGCATGAGCATTTGGGTACCATGGAAGATTATGATCATCGCAAACATGAAAGTGATGAGGCTACGTATGCTTATTCTGTTAGTAATAAAGGAGCAGATGGAGAACCAGAAACATCCACAAAAAAGAGAAAAGATGCAAAACAAAAAGATGATACTGAAATAGGAAAAGATGACCTTATTACTTCAAAGAAGATGCCTGTAATCTGGTCGATTGAGCTTCATCAACAATTTGTTAGTGCTGTGAACCACCTGGGAATTGATAAGGCTACACCGAAGAAGATTATGGAATTGATGAATGTGCCAGGTTTAACCAGAGAAAACGTGGCAAACCATTTGCAGAAATATAGACTATATTTGACGAGACTAAAAGAGCTTCCTATCTTGGAGAAAGAGCATATGCCTCCATCATTGCTACATCTGCATATTTTTTGTTGTCCTCTTCTTCATCTTCACAACATTTTGAACCCAAAACGCTGTTCTTGTCTACTTTTGACTCCCTGGTAA
Protein Sequence:
- >Cc11_g07710|Coffea_canephora|ARR-B|Cc11_g07710
MATACKEALPVPLPFPAGLKVLVVDDDLTCLKILEQMLTRCMYRVTTCSQATVALNLLREKKGFFDIVLSEVHVPDMDGFKLLELVSLEMNLPVIMMSVDDRTSIVVKGIMQGACDYLIKPIRFEELKNIWQHVVRKRCNKGKEHEHLGTMEDYDHRKHESDEATYAYSVSNKGADGEPETSTKKRKDAKQKDDTEIGKDDLITSKKMPVIWSIELHQQFVSAVNHLGIDKATPKKIMELMNVPGLTRENVANHLQKYRLYLTRLKELPILEKEHMPPSLLHLHIFCCPLLHLHNILNPKRCSCLLLTPW*