Gene Details:

  • Gene ID: Cagra.0345s0004.1.p
  • Gene Family: ARR-B Family
  • Description: ARR-B Family protein
  • Species: Capsella grandiflora
  • Source: ARR-B family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_023633365.1  — putative two-component response regulator-like APRR4
  • Swissprot:  Q9FJ16  — APRR4_ARATH; Putative two-component response regulator-like APRR4
  • TrEMBL:  R0EZ82  — R0EZ82_9BRAS; Uncharacterized protein
  • STRING:  Cagra.0345s0004.1.p  — (Capsella grandiflora)

Gene Ontology:

  • GO:0000160  — Biological Process — phosphorelay signal transduction system
  • GO:0003677  — Molecular Function — DNA binding

Family Introduction:

  • The Arabidopsis genome codes for 22 response regulators (ARRs), 12 of which contain a Myb-like DNA binding domain called ARRM (type B). The remainder (type A) possess no apparent functional unit other than a signal receiver domain containing two aspartate and one lysine residues (DDK) at invariant positions, and their genes are transcriptionally induced by cytokinins without de novo protein synthesis. The type B members, ARR1 and ARR2, bind DNA in a sequence-specific manner and work as transcriptional activators.
  • Here we present evidence that ARR1 mediates a cytokinin signal, probably through its NH2-terminal signal receiver domain, and transactivates ARR6, which is immediately responsive to cytokinins. A paralogous response regulator, ARR2, shows almost identical characteristics to ARR1, suggesting a functional overlap. Residual cytokinin responses observed with the arr1-1 mutant may have been provided by ARR2. In addition to ARR6, other type A member genes, including ARR4, ARR5, ARR7, ARR8, and ARR9, were also activated by DEX at various levels in 35S::ARR1DDK::GR plants, suggesting that all the immediate cytokinin-responsive genes belonging to this group are directly activated by ARR1. Also, other cytokinin-responsive genes whose promoter regions contain the ARR1 recognition sequences are possibly transactivated by ARR1. A screening for ARR1 target genes using transgenic 35S::ARR1-DDK::GR plants will shed light on the whole view of the early cytokinin signal transduction pathway. We conclude that ARR1 is a principal transcription factor-type response regulator that is involved in an early step of cytokinin signal transduction, possibly as a partner of the sensor histidine kinase CRE1.

Literature:

Sequences:

CDS Sequence:
  • >Cagra.0345s0004.1.p|Capsella_grandiflora|ARR-B|Cagra.0345s0004.1.p
    ATGGCTGTGACTTTCGACCACGGTGGAGTTCCGGCTAGTGACGGTGGTGGTGATCCATTTGGAGATCAGCATCCTAACTTCTCCGATGTGTTTCCAAGAAACTTCCCGGAGAGTTTGCGAGTGTTAGTCTTCGATGAAGATCCTGCCTATCTTCTCATATTAGAGAGACATCTCCAAGCTTTTCGATACCGAGTGACTACATGCAACGAAGAGAGTGAAGCTATGACTCTACTCCGCGACCATAGGAATATGTTCGACATCGCTATGATACATGCAAATAATTCAGACGGTGATAGGATCCGGTTTATCTCGGAAATCGGATCAGAAATGGATCTTTCATTCATAATAATATCTAAAGACGACTCAGTAGAATCGGTGGTGAAGTGGATGAGTACCACCACTGCTTGTGACTATCTAATAAAACCGATACGACCCGAAGATCTACGGATGATATTCAAACACGTGGTGAAGAAGTTTCTTGGAAGAAGGAGGAGTGTGGTGACCGTAGAGGGAGATCAAGAGAAAGCAGCAGCACGTGAGAAGTCATCTTCGGTGGGAGATTCCACCATAAGAAGCCCTGATGATGACCAGGCCGGCAAAAGAAGTAGCTGCCCTAACGCAGAAGTCGTCAACGAGGATGATCATGATCATGATCGTGTTACCTCCAAGAAAAGACGACGAGTCGTTTGGGACACTGAGCTTCATCAAAGGTTTCTCGACGCCGTGAACAGTGTTGGATTCGAAAAAGCTGTTCCCAAGAAAATTTTAGAGCAAATGAATGTTGAAAACCTCAGTCGAGAAAACGTAGCCAGTCATCTCCAG
Protein Sequence:
  • >Cagra.0345s0004.1.p|Capsella_grandiflora|ARR-B|Cagra.0345s0004.1.p
    MAVTFDHGGVPASDGGGDPFGDQHPNFSDVFPRNFPESLRVLVFDEDPAYLLILERHLQAFRYRVTTCNEESEAMTLLRDHRNMFDIAMIHANNSDGDRIRFISEIGSEMDLSFIIISKDDSVESVVKWMSTTTACDYLIKPIRPEDLRMIFKHVVKKFLGRRRSVVTVEGDQEKAAAREKSSSVGDSTIRSPDDDQAGKRSSCPNAEVVNEDDHDHDRVTSKKRRRVVWDTELHQRFLDAVNSVGFEKAVPKKILEQMNVENLSRENVASHLQ